Result : Q4FMR6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S18 |
| NCBI Accession ID | CP000084.1 |
| Organism | Pelagibacter ubique (strain HTCC1062) |
| Left | 689257 |
| Right | 689535 |
| Strand | - |
| Nucleotide Sequence | ATGCCATCAAAAAAAAGAGCAGGAAATAAAAAGAAAGGTAGTCAAAGTAATTTTGCAAAGCTAAGCATCTTTCAGCCTAATAAATATAAATTTAAGAAAACTTGCCCTTTATCTGCTAAGGGTGCTCCAGAAGTTGATTATAAAAACATCAGATTGTTAAAAAAATATATGTCTGAAAATGGTAAAATTTTACCATCAAGAATTACGAATGTTTCACAAAAAAAACAAAGAGAGCTATCTCTGTCTATTAAGAGAGCTAGAAATTTAGCGTTAATTTAA |
| Sequence | MPSKKRAGNKKKGSQSNFAKLSIFQPNKYKFKKTCPLSAKGAPEVDYKNIRLLKKYMSENGKILPSRITNVSQKKQRELSLSIKRARNLALI |
| Source of smORF | Swiss-Prot |
| Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
| Pubmed ID | 16109880 |
| Domain | CDD:412341 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q4FMR6 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 589629 | 589877 | - | NC_014932.1 | Bartonella clarridgeiae 73 |
| 2 | 2622066 | 2622293 | + | NZ_CP012661.1 | Defluviimonas alba |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_014932.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03948.16 | 1.0 | 2 | 579.0 | same-strand | Ribosomal protein L9, C-terminal domain |
| 2 | PF01281.21 | 1.0 | 2 | 579.0 | same-strand | Ribosomal protein L9, N-terminal domain |
| 3 | PF01250.19 | 1.0 | 2 | 14.0 | same-strand | Ribosomal protein S6 |
++ More..