Protein Information |
Information Type | Description |
---|---|
Protein name | 30S ribosomal protein S18 |
NCBI Accession ID | CP000084.1 |
Organism | Pelagibacter ubique (strain HTCC1062) |
Left | 689257 |
Right | 689535 |
Strand | - |
Nucleotide Sequence | ATGCCATCAAAAAAAAGAGCAGGAAATAAAAAGAAAGGTAGTCAAAGTAATTTTGCAAAGCTAAGCATCTTTCAGCCTAATAAATATAAATTTAAGAAAACTTGCCCTTTATCTGCTAAGGGTGCTCCAGAAGTTGATTATAAAAACATCAGATTGTTAAAAAAATATATGTCTGAAAATGGTAAAATTTTACCATCAAGAATTACGAATGTTTCACAAAAAAAACAAAGAGAGCTATCTCTGTCTATTAAGAGAGCTAGAAATTTAGCGTTAATTTAA |
Sequence | MPSKKRAGNKKKGSQSNFAKLSIFQPNKYKFKKTCPLSAKGAPEVDYKNIRLLKKYMSENGKILPSRITNVSQKKQRELSLSIKRARNLALI |
Source of smORF | Swiss-Prot |
Function | Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000255|HAMAP-Rule:MF_00270}. |
Pubmed ID | 16109880 |
Domain | CDD:412341 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q4FMR6 |
ORF Length (Amino Acid) | 92 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 589629 | 589877 | - | NC_014932.1 | Bartonella clarridgeiae 73 |
2 | 2622066 | 2622293 | + | NZ_CP012661.1 | Defluviimonas alba |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03948.16 | 1.0 | 2 | 579.0 | same-strand | Ribosomal protein L9, C-terminal domain |
2 | PF01281.21 | 1.0 | 2 | 579.0 | same-strand | Ribosomal protein L9, N-terminal domain |
3 | PF01250.19 | 1.0 | 2 | 14.0 | same-strand | Ribosomal protein S6 |