ProsmORF-pred
Result : Q49946
Protein Information
Information Type Description
Protein name Putative ESAT-6-like protein X
NCBI Accession ID U15180.1
Organism Mycobacterium leprae (strain TN)
Left 2055
Right 2342
Strand +
Nucleotide Sequence ATGGGAAACATTAACTACCAGTTTGGGGAGATCGACGCACATGGAGCGGCTATCCGCGCTCAAGCGGCTGCGTTGGAGACCACCCACCAGGCCATTCTAGCCACTGTGCGGGACGCCGCTGAGTTTTGGGGCGGACAAGGTTCGACTGCCCATGAAATGTTCATAGCCGACCTGGGTCGTAACTTCCAGATGATTTACGAGCAGGCCAACTCTCACGGCCAAAAGGTGCAACGCGCCAGCTCCTCCATGGCTGACACTGACCGCTCTGTCAGTTCCGCTTGGTCCTAA
Sequence MGNINYQFGEIDAHGAAIRAQAAALETTHQAILATVRDAAEFWGGQGSTAHEMFIADLGRNFQMIYEQANSHGQKVQRASSSMADTDRSVSSAWS
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl02005. Profile Description: Proteins of 100 residues with WXG. T7SS_ESX-EspC is a family of exported virulence proteins from largely Acinetobacteria and a few Fimicutes, Gram-positive bacteria. It is exported in conjunction with EspA as an interacting pair.ED F8ADQ6.1/227-313; F8ADQ6.1/227-313;
Pubmed ID 11234002
Domain CDD:413154
Functional Category Others
Uniprot ID Q49946
ORF Length (Amino Acid) 95
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 35
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 946614 946901 + NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
2 3134697 3134984 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
3 2949994 2950281 + NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
4 3352525 3352812 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
5 1803123 1803410 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
6 3357433 3357720 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
7 1326499 1326786 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
8 2958593 2958880 + NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
9 3300101 3300385 + NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
10 2760124 2760363 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
11 2661392 2661676 - NZ_AP024310.1 Mycobacterium heckeshornense
12 2646376 2646660 - NZ_AP024310.1 Mycobacterium heckeshornense
13 1312092 1312376 - NZ_AP024310.1 Mycobacterium heckeshornense
14 3519674 3519931 - NZ_AP022583.1 Mycobacterium noviomagense
15 4211883 4212167 + NZ_AP022583.1 Mycobacterium noviomagense
16 749678 749962 + NZ_AP022583.1 Mycobacterium noviomagense
17 4229014 4229298 + NZ_AP022583.1 Mycobacterium noviomagense
18 4244653 4244937 + NZ_AP022583.1 Mycobacterium noviomagense
19 3471718 3472002 - NZ_AP022583.1 Mycobacterium noviomagense
20 3473503 3473742 - NZ_AP022583.1 Mycobacterium noviomagense
21 2607072 2607356 - NZ_AP022606.1 Mycobacterium branderi
22 2754980 2755264 + NZ_AP022606.1 Mycobacterium branderi
23 2540633 2540917 - NZ_AP022606.1 Mycobacterium branderi
24 4131405 4131644 - NZ_AP022606.1 Mycobacterium branderi
25 2608318 2608602 - NZ_AP022606.1 Mycobacterium branderi
26 4118721 4118960 - NZ_AP022606.1 Mycobacterium branderi
27 509312 509596 - NZ_AP022607.1 Mycobacterium branderi
28 491771 492055 - NZ_AP022607.1 Mycobacterium branderi
29 9737 9994 + NZ_AP022575.1 Mycobacterium shinjukuense
30 4496085 4496342 + NZ_AP022575.1 Mycobacterium shinjukuense
31 996091 996348 + NZ_AP022575.1 Mycobacterium shinjukuense
32 1547833 1548090 - NZ_AP022575.1 Mycobacterium shinjukuense
33 4164553 4164810 + NZ_AP022575.1 Mycobacterium shinjukuense
34 268743 269000 - NZ_AP022575.1 Mycobacterium shinjukuense
35 986961 987218 + NZ_AP022575.1 Mycobacterium shinjukuense
36 1238649 1238888 + NZ_AP022590.1 Mycobacterium mantenii
37 5773825 5774064 - NZ_AP022590.1 Mycobacterium mantenii
38 5018537 5018821 + NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
39 384237 384521 + NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
40 4035784 4036068 - NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
41 2987045 2987329 + NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
42 3960136 3960420 + NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
43 1062918 1063202 - NC_016946.1 Mycobacterium intracellulare ATCC 13950
44 2868829 2869113 - NC_016946.1 Mycobacterium intracellulare ATCC 13950
45 3910058 3910342 + NZ_AP022572.1 Mycobacterium shottsii
46 226963 227247 + NZ_AP022572.1 Mycobacterium shottsii
47 579515 579799 - NZ_AP022572.1 Mycobacterium shottsii
48 3193618 3193902 + NZ_AP022572.1 Mycobacterium shottsii
49 3187180 3187437 + NZ_AP022572.1 Mycobacterium shottsii
50 2748616 2748900 - NC_016948.1 Mycobacterium paraintracellulare
51 1076567 1076851 - NC_016948.1 Mycobacterium paraintracellulare
52 3242725 3243009 - NZ_AP022573.1 Mycobacterium saskatchewanense
53 2484187 2484444 + NZ_AP022573.1 Mycobacterium saskatchewanense
54 1597041 1597298 - NZ_AP022573.1 Mycobacterium saskatchewanense
55 1598300 1598584 - NZ_AP022573.1 Mycobacterium saskatchewanense
56 721474 721758 + NZ_AP022573.1 Mycobacterium saskatchewanense
57 3320844 3321101 + NZ_AP022581.1 Mycobacterium lacus
58 2565408 2565692 - NZ_AP022581.1 Mycobacterium lacus
59 2573573 2573830 - NZ_AP022581.1 Mycobacterium lacus
60 1857436 1857693 + NZ_AP022581.1 Mycobacterium lacus
61 679602 679859 + NZ_AP022581.1 Mycobacterium lacus
62 2534707 2534991 - NZ_CP009360.4 Mycobacterium avium subsp. hominissuis
63 1059952 1060236 - NZ_CP009360.4 Mycobacterium avium subsp. hominissuis
64 2724787 2725071 + NZ_CP009360.4 Mycobacterium avium subsp. hominissuis
65 2653709 2653993 - NZ_CP023147.1 Mycobacterium marseillense
66 1045524 1045808 - NZ_CP023147.1 Mycobacterium marseillense
67 3894229 3894513 - NZ_AP022568.1 Mycobacterium simiae
68 5568744 5569028 - NZ_AP022568.1 Mycobacterium simiae
69 5313977 5314261 - NZ_AP022568.1 Mycobacterium simiae
70 2001230 2001469 + NZ_LT906469.1 Mycolicibacter terrae
71 2481832 2482071 - NZ_LT906469.1 Mycolicibacter terrae
72 2460317 2460556 + NZ_LT906469.1 Mycolicibacter terrae
73 1992355 1992594 + NZ_LT906469.1 Mycolicibacter terrae
74 1512184 1512423 + NZ_AP022582.1 Mycobacterium seoulense
75 3004730 3004969 + NZ_AP022582.1 Mycobacterium seoulense
76 3768666 3768950 - NZ_AP022582.1 Mycobacterium seoulense
77 789320 789559 + NZ_AP022619.1 Mycobacterium paraseoulense
78 2932705 2932944 + NZ_AP022619.1 Mycobacterium paraseoulense
79 3606409 3606693 - NZ_AP022619.1 Mycobacterium paraseoulense
80 49397 49681 + NC_022663.1 Mycobacterium kansasii ATCC 12478
81 1875009 1875293 + NC_022663.1 Mycobacterium kansasii ATCC 12478
82 1055621 1055905 - NC_022663.1 Mycobacterium kansasii ATCC 12478
83 2755083 2755367 - NC_022663.1 Mycobacterium kansasii ATCC 12478
84 1012449 1012733 - NZ_CP058277.1 Mycobacterium marinum
85 5769232 5769516 - NZ_CP058277.1 Mycobacterium marinum
86 4636171 4636455 + NZ_CP058277.1 Mycobacterium marinum
87 285123 285407 + NZ_CP058277.1 Mycobacterium marinum
88 5692449 5692733 + NZ_CP058277.1 Mycobacterium marinum
89 5777811 5778068 - NZ_CP058277.1 Mycobacterium marinum
90 5775695 5775952 - NZ_CP058277.1 Mycobacterium marinum
91 502343 502582 + NZ_AP022609.1 Mycolicibacter hiberniae
92 2096178 2096417 + NZ_AP022609.1 Mycolicibacter hiberniae
93 1927665 1927904 - NZ_AP022609.1 Mycolicibacter hiberniae
94 1474005 1474244 + NZ_AP022609.1 Mycolicibacter hiberniae
95 1482790 1483029 + NZ_AP022609.1 Mycolicibacter hiberniae
96 570661 570945 - NZ_AP022609.1 Mycolicibacter hiberniae
97 4471320 4471604 + NZ_LR130759.1 Mycobacterium basiliense
98 3708076 3708360 - NZ_LR130759.1 Mycobacterium basiliense
99 2793786 2794070 + NZ_LR130759.1 Mycobacterium basiliense
100 3720053 3720292 - NZ_LR130759.1 Mycobacterium basiliense
101 370559 370843 + NZ_AP022569.1 Mycobacterium cookii
102 1991099 1991383 + NZ_AP022569.1 Mycobacterium cookii
103 2252725 2253009 + NZ_AP022569.1 Mycobacterium cookii
104 2324096 2324380 + NZ_AP022569.1 Mycobacterium cookii
105 906865 907104 + NZ_AP022569.1 Mycobacterium cookii
106 3898782 3899021 + NZ_AP022615.1 Mycobacterium heidelbergense
107 4575271 4575510 - NZ_AP022615.1 Mycobacterium heidelbergense
108 3204237 3204476 - NZ_AP022615.1 Mycobacterium heidelbergense
109 3900077 3900316 + NZ_AP022615.1 Mycobacterium heidelbergense
110 3821076 3821315 + NZ_AP022589.1 Mycolicibacter minnesotensis
111 3829879 3830118 + NZ_AP022589.1 Mycolicibacter minnesotensis
112 44929 45168 - NZ_AP022589.1 Mycolicibacter minnesotensis
113 224174 224413 + NZ_AP022589.1 Mycolicibacter minnesotensis
114 3760464 3760748 - NZ_AP022613.1 Mycobacterium conspicuum
115 2831338 2831622 + NZ_AP022613.1 Mycobacterium conspicuum
116 4652550 4652834 + NZ_AP022613.1 Mycobacterium conspicuum
117 1861157 1861441 + NZ_AP022613.1 Mycobacterium conspicuum
118 4522660 4522899 - NZ_CP025546.1 Mycobacterium paragordonae
119 4519312 4519551 - NZ_CP025546.1 Mycobacterium paragordonae
120 3398087 3398371 + NZ_CP025546.1 Mycobacterium paragordonae
121 5493034 5493318 + NZ_CP025546.1 Mycobacterium paragordonae
122 5134150 5134389 - NZ_AP022587.1 Mycobacterium stomatepiae
123 511238 511477 + NZ_AP022587.1 Mycobacterium stomatepiae
124 781951 782190 - NZ_AP022587.1 Mycobacterium stomatepiae
125 5881739 5881978 + NZ_AP022587.1 Mycobacterium stomatepiae
126 2730802 2731086 + NZ_AP018164.1 Mycobacterium shigaense
127 4249103 4249387 + NZ_AP018164.1 Mycobacterium shigaense
128 4883171 4883410 - NZ_AP022576.1 Mycobacterium florentinum
129 676588 676827 - NZ_AP022576.1 Mycobacterium florentinum
130 5644561 5644800 + NZ_AP022576.1 Mycobacterium florentinum
131 4059984 4060223 - NC_000962.3 Mycobacterium tuberculosis H37Rv
132 1160544 1160783 - NC_000962.3 Mycobacterium tuberculosis H37Rv
133 2030739 2030978 + NC_000962.3 Mycobacterium tuberculosis H37Rv
134 1341051 1341290 + NC_000962.3 Mycobacterium tuberculosis H37Rv
135 2625888 2626127 - NC_000962.3 Mycobacterium tuberculosis H37Rv
136 2073698 2073937 + NC_015848.1 Mycobacterium canettii CIPT 140010059
137 2682991 2683230 - NC_015848.1 Mycobacterium canettii CIPT 140010059
138 1171359 1171598 - NC_015848.1 Mycobacterium canettii CIPT 140010059
139 1361107 1361346 + NC_015848.1 Mycobacterium canettii CIPT 140010059
140 2691404 2691643 - NC_015848.1 Mycobacterium canettii CIPT 140010059
141 4115384 4115623 - NC_015848.1 Mycobacterium canettii CIPT 140010059
142 66052 66336 - NC_022654.1 Mycobacterium kansasii ATCC 12478
143 5917610 5917867 - NZ_AP022614.1 Mycobacterium parmense
144 1553272 1553529 - NZ_AP022614.1 Mycobacterium parmense
145 658807 659064 + NZ_AP022614.1 Mycobacterium parmense
146 4392987 4393226 - NZ_AP022562.1 Mycobacterium novum
147 911854 912093 + NZ_AP022562.1 Mycobacterium novum
148 4384151 4384390 - NZ_AP022562.1 Mycobacterium novum
149 3884629 3884868 + NZ_AP022562.1 Mycobacterium novum
150 1073897 1074136 - NC_015576.1 Mycolicibacter sinensis
151 2065374 2065613 + NC_015576.1 Mycolicibacter sinensis
152 2074209 2074448 + NC_015576.1 Mycolicibacter sinensis
153 2563323 2563562 - NC_015576.1 Mycolicibacter sinensis
154 53185 53475 + NZ_CP025547.1 Mycobacterium paragordonae
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP011883.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00934.22 1.0 35 1667 same-strand PE family
2 PF00823.21 1.0 35 1008 same-strand PPE family
3 PF06013.14 1.0 35 66 same-strand Proteins of 100 residues with WXG
4 PF12484.10 1.0 35 1308 same-strand PPE-SVP subfamily C-terminal region
5 PF00072.26 0.89 31 499 same-strand Response regulator receiver domain
6 PF00486.30 0.89 31 499 same-strand Transcriptional regulatory protein, C terminal
7 PF00512.27 0.94 33 2172 same-strand His Kinase A (phospho-acceptor) domain
8 PF02518.28 0.94 33 2172 same-strand Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
9 PF00672.27 0.86 30 2585 same-strand HAMP domain
10 PF00004.31 0.83 29 5722 same-strand ATPase family associated with various cellular activities (AAA)
11 PF11203.10 0.97 34 4527 same-strand Putative type VII ESX secretion system translocon, EccE
12 PF08817.12 0.97 34 1263 same-strand WXG100 protein secretion system (Wss), protein YukD
13 PF14011.8 0.97 34 91 same-strand EspG family
14 PF19053.2 0.86 30 1263.0 same-strand EccD-like transmembrane domain
++ More..