ProsmORF-pred
Result : Q49945
Protein Information
Information Type Description
Protein name Putative ESAT-6-like protein Y
NCBI Accession ID U15180.1
Organism Mycobacterium leprae (strain TN)
Left 1701
Right 2003
Strand +
Nucleotide Sequence ATGACAGCTGCACATTTTATGACCGACCCACAGGCGATGCGGGACATGGCGCGCAAATTTGACATGCACGCCCAGAACGTGCGAGACGAGTCCCACAAGATGTTCATGTCCTCGATGGACATCGCTGGTGCGGGCTGGAGTGGGACCGCCCAGTTGACCTCCCACGACACCATGGGGCAGATAAATCAGGCGTTTCGCCACATAGTGACCCTGCTGCAGGACGTGCGTGACCAGCTGGGTACCGCCGCCGATCGCTACGAGCACCAAGAAGAGAACTCGAGGAAAATCCTTTCTGGCAGCTAG
Sequence MTAAHFMTDPQAMRDMARKFDMHAQNVRDESHKMFMSSMDIAGAGWSGTAQLTSHDTMGQINQAFRHIVTLLQDVRDQLGTAADRYEHQEENSRKILSGS
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl02005. Profile Description: Proteins of 100 residues with WXG. T7SS_ESX-EspC is a family of exported virulence proteins from largely Acinetobacteria and a few Fimicutes, Gram-positive bacteria. It is exported in conjunction with EspA as an interacting pair.ED F8ADQ6.1/227-313; F8ADQ6.1/227-313;
Pubmed ID 11234002
Domain CDD:413154
Functional Category Others
Uniprot ID Q49945
ORF Length (Amino Acid) 100
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 35
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2958266 2958523 + NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
2 3352881 3353138 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
3 1326855 1327112 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
4 2949668 2949925 + NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
5 3357789 3358046 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
6 946288 946545 + NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
7 3135052 3135309 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
8 1803478 1803735 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
9 3299795 3300049 + NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
10 2206854 2207108 + NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
11 2760467 2760721 - NZ_CP011883.2 Mycobacterium haemophilum DSM 44634
12 3898397 3898696 + NZ_AP022615.1 Mycobacterium heidelbergense
13 4575606 4575860 - NZ_AP022615.1 Mycobacterium heidelbergense
14 3899730 3899984 + NZ_AP022615.1 Mycobacterium heidelbergense
15 3204569 3204823 - NZ_AP022615.1 Mycobacterium heidelbergense
16 3243021 3243275 - NZ_AP022573.1 Mycobacterium saskatchewanense
17 1598596 1598850 - NZ_AP022573.1 Mycobacterium saskatchewanense
18 1597363 1597617 - NZ_AP022573.1 Mycobacterium saskatchewanense
19 2483868 2484122 + NZ_AP022573.1 Mycobacterium saskatchewanense
20 721169 721423 + NZ_AP022573.1 Mycobacterium saskatchewanense
21 2540986 2541240 - NZ_AP022606.1 Mycobacterium branderi
22 4131749 4132003 - NZ_AP022606.1 Mycobacterium branderi
23 4119017 4119271 - NZ_AP022606.1 Mycobacterium branderi
24 2608626 2608880 - NZ_AP022606.1 Mycobacterium branderi
25 2754657 2754911 + NZ_AP022606.1 Mycobacterium branderi
26 2607425 2607679 - NZ_AP022606.1 Mycobacterium branderi
27 492123 492377 - NZ_AP022607.1 Mycobacterium branderi
28 509664 509918 - NZ_AP022607.1 Mycobacterium branderi
29 1045851 1046105 - NZ_CP023147.1 Mycobacterium marseillense
30 2654036 2654290 - NZ_CP023147.1 Mycobacterium marseillense
31 3606733 3606987 - NZ_AP022619.1 Mycobacterium paraseoulense
32 788970 789224 + NZ_AP022619.1 Mycobacterium paraseoulense
33 2932362 2932616 + NZ_AP022619.1 Mycobacterium paraseoulense
34 3473830 3474084 - NZ_AP022583.1 Mycobacterium noviomagense
35 3519998 3520252 - NZ_AP022583.1 Mycobacterium noviomagense
36 3472042 3472296 - NZ_AP022583.1 Mycobacterium noviomagense
37 4228732 4228986 + NZ_AP022583.1 Mycobacterium noviomagense
38 4244371 4244625 + NZ_AP022583.1 Mycobacterium noviomagense
39 749395 749649 + NZ_AP022583.1 Mycobacterium noviomagense
40 4211578 4211832 + NZ_AP022583.1 Mycobacterium noviomagense
41 2535034 2535288 - NZ_CP009360.4 Mycobacterium avium subsp. hominissuis
42 1060279 1060533 - NZ_CP009360.4 Mycobacterium avium subsp. hominissuis
43 2724521 2724775 + NZ_CP009360.4 Mycobacterium avium subsp. hominissuis
44 2869155 2869409 - NC_016946.1 Mycobacterium intracellulare ATCC 13950
45 1063244 1063498 - NC_016946.1 Mycobacterium intracellulare ATCC 13950
46 2748942 2749196 - NC_016948.1 Mycobacterium paraintracellulare
47 1076893 1077147 - NC_016948.1 Mycobacterium paraintracellulare
48 66381 66635 - NC_022654.1 Mycobacterium kansasii ATCC 12478
49 3768990 3769244 - NZ_AP022582.1 Mycobacterium seoulense
50 1511834 1512088 + NZ_AP022582.1 Mycobacterium seoulense
51 3004389 3004643 + NZ_AP022582.1 Mycobacterium seoulense
52 1312406 1312660 - NZ_AP024310.1 Mycobacterium heckeshornense
53 2661706 2661960 - NZ_AP024310.1 Mycobacterium heckeshornense
54 2647152 2647406 - NZ_AP024310.1 Mycobacterium heckeshornense
55 52891 53145 + NZ_CP025547.1 Mycobacterium paragordonae
56 4883504 4883758 - NZ_AP022576.1 Mycobacterium florentinum
57 676921 677175 - NZ_AP022576.1 Mycobacterium florentinum
58 5644220 5644474 + NZ_AP022576.1 Mycobacterium florentinum
59 5134483 5134737 - NZ_AP022587.1 Mycobacterium stomatepiae
60 510890 511144 + NZ_AP022587.1 Mycobacterium stomatepiae
61 782284 782538 - NZ_AP022587.1 Mycobacterium stomatepiae
62 5881412 5881666 + NZ_AP022587.1 Mycobacterium stomatepiae
63 4248798 4249052 + NZ_AP018164.1 Mycobacterium shigaense
64 2730498 2730752 + NZ_AP018164.1 Mycobacterium shigaense
65 1874716 1874970 + NC_022663.1 Mycobacterium kansasii ATCC 12478
66 1055944 1056198 - NC_022663.1 Mycobacterium kansasii ATCC 12478
67 2755396 2755650 - NC_022663.1 Mycobacterium kansasii ATCC 12478
68 49092 49346 + NC_022663.1 Mycobacterium kansasii ATCC 12478
69 1553592 1553846 - NZ_AP022614.1 Mycobacterium parmense
70 5917930 5918184 - NZ_AP022614.1 Mycobacterium parmense
71 658490 658744 + NZ_AP022614.1 Mycobacterium parmense
72 1238298 1238552 + NZ_AP022590.1 Mycobacterium mantenii
73 5774154 5774408 - NZ_AP022590.1 Mycobacterium mantenii
74 2986739 2986993 + NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
75 4036131 4036385 - NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
76 5018244 5018498 + NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
77 383944 384198 + NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
78 3958382 3958642 + NZ_AP018410.1 Mycobacterium pseudoshottsii JCM 15466
79 4635865 4636119 + NZ_CP058277.1 Mycobacterium marinum
80 284830 285084 + NZ_CP058277.1 Mycobacterium marinum
81 5769579 5769833 - NZ_CP058277.1 Mycobacterium marinum
82 1012772 1013026 - NZ_CP058277.1 Mycobacterium marinum
83 5778110 5778364 - NZ_CP058277.1 Mycobacterium marinum
84 5775994 5776248 - NZ_CP058277.1 Mycobacterium marinum
85 5692071 5692331 + NZ_CP058277.1 Mycobacterium marinum
86 3894559 3894813 - NZ_AP022568.1 Mycobacterium simiae
87 5569078 5569332 - NZ_AP022568.1 Mycobacterium simiae
88 3760797 3761051 - NZ_AP022613.1 Mycobacterium conspicuum
89 4652244 4652498 + NZ_AP022613.1 Mycobacterium conspicuum
90 2831032 2831286 + NZ_AP022613.1 Mycobacterium conspicuum
91 1860856 1861110 + NZ_AP022613.1 Mycobacterium conspicuum
92 370268 370522 + NZ_AP022569.1 Mycobacterium cookii
93 906522 906776 + NZ_AP022569.1 Mycobacterium cookii
94 1990808 1991062 + NZ_AP022569.1 Mycobacterium cookii
95 2252434 2252688 + NZ_AP022569.1 Mycobacterium cookii
96 2323805 2324059 + NZ_AP022569.1 Mycobacterium cookii
97 3909752 3910006 + NZ_AP022572.1 Mycobacterium shottsii
98 226670 226924 + NZ_AP022572.1 Mycobacterium shottsii
99 3193301 3193555 + NZ_AP022572.1 Mycobacterium shottsii
100 579838 580092 - NZ_AP022572.1 Mycobacterium shottsii
101 3186884 3187138 + NZ_AP022572.1 Mycobacterium shottsii
102 2790165 2790428 - NZ_AP022572.1 Mycobacterium shottsii
103 679262 679561 + NZ_AP022581.1 Mycobacterium lacus
104 2573871 2574170 - NZ_AP022581.1 Mycobacterium lacus
105 2565754 2566008 - NZ_AP022581.1 Mycobacterium lacus
106 1857105 1857359 + NZ_AP022581.1 Mycobacterium lacus
107 3320513 3320767 + NZ_AP022581.1 Mycobacterium lacus
108 986624 986923 + NZ_AP022575.1 Mycobacterium shinjukuense
109 1548156 1548452 - NZ_AP022575.1 Mycobacterium shinjukuense
110 995771 996025 + NZ_AP022575.1 Mycobacterium shinjukuense
111 4164233 4164487 + NZ_AP022575.1 Mycobacterium shinjukuense
112 269066 269320 - NZ_AP022575.1 Mycobacterium shinjukuense
113 4519658 4519912 - NZ_CP025546.1 Mycobacterium paragordonae
114 5492750 5493004 + NZ_CP025546.1 Mycobacterium paragordonae
115 3397803 3398057 + NZ_CP025546.1 Mycobacterium paragordonae
116 2691703 2692002 - NC_015848.1 Mycobacterium canettii CIPT 140010059
117 2073348 2073602 + NC_015848.1 Mycobacterium canettii CIPT 140010059
118 1171670 1171924 - NC_015848.1 Mycobacterium canettii CIPT 140010059
119 1360757 1361011 + NC_015848.1 Mycobacterium canettii CIPT 140010059
120 2683326 2683580 - NC_015848.1 Mycobacterium canettii CIPT 140010059
121 4115695 4115949 - NC_015848.1 Mycobacterium canettii CIPT 140010059
122 2793481 2793735 + NZ_LR130759.1 Mycobacterium basiliense
123 4471027 4471281 + NZ_LR130759.1 Mycobacterium basiliense
124 3708399 3708653 - NZ_LR130759.1 Mycobacterium basiliense
125 3720364 3720618 - NZ_LR130759.1 Mycobacterium basiliense
126 1340701 1340955 + NC_000962.3 Mycobacterium tuberculosis H37Rv
127 2626223 2626477 - NC_000962.3 Mycobacterium tuberculosis H37Rv
128 1160855 1161109 - NC_000962.3 Mycobacterium tuberculosis H37Rv
129 4060295 4060549 - NC_000962.3 Mycobacterium tuberculosis H37Rv
130 1927972 1928229 - NZ_AP022609.1 Mycolicibacter hiberniae
131 1473629 1473928 + NZ_AP022609.1 Mycolicibacter hiberniae
132 2095844 2096101 + NZ_AP022609.1 Mycolicibacter hiberniae
133 1482474 1482728 + NZ_AP022609.1 Mycolicibacter hiberniae
134 502026 502280 + NZ_AP022609.1 Mycolicibacter hiberniae
135 570978 571241 - NZ_AP022609.1 Mycolicibacter hiberniae
136 45234 45491 - NZ_AP022589.1 Mycolicibacter minnesotensis
137 223810 224109 + NZ_AP022589.1 Mycolicibacter minnesotensis
138 3829556 3829813 + NZ_AP022589.1 Mycolicibacter minnesotensis
139 3820711 3821010 + NZ_AP022589.1 Mycolicibacter minnesotensis
140 1992034 1992288 + NZ_LT906469.1 Mycolicibacter terrae
141 2000909 2001163 + NZ_LT906469.1 Mycolicibacter terrae
142 2459996 2460250 + NZ_LT906469.1 Mycolicibacter terrae
143 2482138 2482392 - NZ_LT906469.1 Mycolicibacter terrae
144 3884309 3884563 + NZ_AP022562.1 Mycobacterium novum
145 911498 911794 + NZ_AP022562.1 Mycobacterium novum
146 4393286 4393582 - NZ_AP022562.1 Mycobacterium novum
147 4384456 4384710 - NZ_AP022562.1 Mycobacterium novum
148 2563628 2563882 - NC_015576.1 Mycolicibacter sinensis
149 1074196 1074492 - NC_015576.1 Mycolicibacter sinensis
150 2065012 2065308 + NC_015576.1 Mycolicibacter sinensis
151 2073889 2074143 + NC_015576.1 Mycolicibacter sinensis
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP011883.2
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00934.22 1.0 35 1370 same-strand PE family
2 PF00823.21 1.0 35 994.5 same-strand PPE family
3 PF12484.10 1.0 35 1285 same-strand PPE-SVP subfamily C-terminal region
4 PF06013.14 1.0 35 44 same-strand Proteins of 100 residues with WXG
5 PF00072.26 0.89 31 813 same-strand Response regulator receiver domain
6 PF00486.30 0.89 31 813 same-strand Transcriptional regulatory protein, C terminal
7 PF00512.27 0.8 28 1553.0 same-strand His Kinase A (phospho-acceptor) domain
8 PF02518.28 0.8 28 1553.0 same-strand Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
9 PF00672.27 0.77 27 1572.0 same-strand HAMP domain
10 PF14011.8 0.97 34 425 same-strand EspG family
11 PF08817.12 0.97 34 1598.5 same-strand WXG100 protein secretion system (Wss), protein YukD
12 PF19053.2 0.86 30 1599 same-strand EccD-like transmembrane domain
13 PF11203.10 0.74 26 4850 same-strand Putative type VII ESX secretion system translocon, EccE
++ More..