Result : Q49760
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein ML0614 |
| NCBI Accession ID | U00016.1 |
| Organism | Mycobacterium leprae (strain TN) |
| Left | 14594 |
| Right | 14881 |
| Strand | + |
| Nucleotide Sequence | ATGTGGAAGGCACGGACAGCATTGGGCGATCTTGACACAGTGTTTTACGATGCGGGGACGGCGAATGGGACGAATGGGATTAGTGTGAGCCCGGTGAACGGGTTCCTGAATTGGTGGGACAGCATCGAGCTTTGGCTGTCAGGGCTCGCCTTCGTGTTACAGGCGGCTTTGGTTATGCCGGTTGTCCTTGCGTTTGCCTACGGCACCGCATTAGTGTTAGATTTCGCGCTCGGTAAGGGCATCCAGTTGATGCGTCGAGCCTATCACCCTGATTCGGCGCGCGGGTAA |
| Sequence | MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLAFVLQAALVMPVVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11234002 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q49760 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 726554 | 726841 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 2 | 2800326 | 2800556 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 3 | 3785756 | 3785986 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 4 | 3831565 | 3831813 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 5 | 1700913 | 1701182 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022613.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.8 | 4 | 3066.5 | same-strand | ABC transporter |
| 2 | PF12857.9 | 0.8 | 4 | 3066.5 | same-strand | TOBE-like domain |
| 3 | PF08402.12 | 0.6 | 3 | 3052 | same-strand | TOBE domain |
| 4 | PF13401.8 | 0.8 | 4 | 3066.5 | same-strand | AAA domain |
| 5 | PF00528.24 | 0.8 | 4 | 1799.5 | same-strand | Binding-protein-dependent transport system inner membrane component |
| 6 | PF13531.8 | 0.8 | 4 | 339.5 | same-strand | Bacterial extracellular solute-binding protein |
| 7 | PF01547.27 | 0.8 | 4 | 339.5 | same-strand | Bacterial extracellular solute-binding protein |
| 8 | PF13416.8 | 0.6 | 3 | 328 | same-strand | Bacterial extracellular solute-binding protein |
| 9 | PF01494.21 | 0.6 | 3 | 75 | opposite-strand | FAD binding domain |
| 10 | PF00009.29 | 0.8 | 4 | 3871.0 | same-strand | Elongation factor Tu GTP binding domain |
| 11 | PF06421.14 | 0.8 | 4 | 3871.0 | same-strand | GTP-binding protein LepA C-terminus |
| 12 | PF00679.26 | 0.8 | 4 | 3871.0 | same-strand | Elongation factor G C-terminus |
| 13 | PF03144.27 | 0.8 | 4 | 3871.0 | same-strand | Elongation factor Tu domain 2 |
| 14 | PF01926.25 | 0.6 | 3 | 3443 | same-strand | 50S ribosome-binding GTPase |
| 15 | PF02452.19 | 0.8 | 4 | 5863.0 | opposite-strand | PemK-like, MazF-like toxin of type II toxin-antitoxin system |
| 16 | PF14032.8 | 0.6 | 3 | 3399 | same-strand | PknH-like extracellular domain |
++ More..