Result : Q49616
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein ML1221 |
| NCBI Accession ID | U00010.1 |
| Organism | Mycobacterium leprae (strain TN) |
| Left | 34393 |
| Right | 34635 |
| Strand | - |
| Nucleotide Sequence | GTGGTTCAGGATCTTCCTACTCCGATCGGTGCGGGCATCTACAACATCTATACCGGTGTCAAACACCGGGATGAACTTGCTGGCGCTTCGATGCCCACAGTGGCCCAGTTAGGCCTGGAGCCTCCTCGGTTTTGCGCGGAATGCGGACGGCGGATGGTTGTGCAGGTTCGTCCCGACGGCTGGCGGGCGAAGTGTTCGCGGCACGGACAGGTGGACTCGGTCGACATGGAGGCAAAGCGGTGA |
| Sequence | MVQDLPTPIGAGIYNIYTGVKHRDELAGASMPTVAQLGLEPPRFCAECGRRMVVQVRPDGWRAKCSRHGQVDSVDMEAKR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11234002 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q49616 |
| ORF Length (Amino Acid) | 80 |
++ More..
| Conservation Analysis |
No. of Species: 103
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1408129 | 1408371 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 2 | 2000738 | 2000965 | + | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 3 | 4306983 | 4307210 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 4 | 1123245 | 1123472 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 5 | 407131 | 407358 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 6 | 970689 | 970928 | - | NZ_AP022565.1 | Mycolicibacterium alvei |
| 7 | 3995383 | 3995610 | - | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 8 | 1118262 | 1118489 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 9 | 4129001 | 4129240 | + | NZ_AP022562.1 | Mycobacterium novum |
| 10 | 2325091 | 2325330 | - | NC_015576.1 | Mycolicibacter sinensis |
| 11 | 4035991 | 4036230 | - | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 12 | 1207020 | 1207247 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 13 | 1046767 | 1046994 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 14 | 4899689 | 4899916 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 15 | 1276759 | 1276998 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 16 | 3054330 | 3054575 | + | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 17 | 2384304 | 2384531 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 18 | 4017038 | 4017268 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 19 | 1895396 | 1895635 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 20 | 5989533 | 5989760 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 21 | 3010986 | 3011213 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 22 | 3240313 | 3240540 | + | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 23 | 127879 | 128106 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 24 | 3218995 | 3219222 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 25 | 3294950 | 3295177 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 26 | 4660243 | 4660491 | - | NZ_AP022598.1 | Mycolicibacterium parafortuitum |
| 27 | 6373232 | 6373480 | + | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 28 | 2930965 | 2931192 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 29 | 2581786 | 2582013 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 30 | 5102461 | 5102697 | - | NZ_CP012150.1 | Mycobacterium goodii |
| 31 | 2500362 | 2500586 | + | NZ_LR130759.1 | Mycobacterium basiliense |
| 32 | 4249501 | 4249728 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 33 | 2838136 | 2838366 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 34 | 2687579 | 2687827 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 35 | 1107809 | 1108048 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 36 | 2618172 | 2618399 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 37 | 4219712 | 4219939 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 38 | 621645 | 621869 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 39 | 3723029 | 3723232 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 40 | 373987 | 374202 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 41 | 3534344 | 3534571 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 42 | 845169 | 845396 | + | NZ_AP022590.1 | Mycobacterium mantenii |
| 43 | 4617478 | 4617726 | - | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 44 | 3542534 | 3542773 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 45 | 253785 | 254024 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 46 | 2970287 | 2970523 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 47 | 2788232 | 2788468 | + | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 48 | 2628572 | 2628787 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 49 | 2964515 | 2964763 | + | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 50 | 1801936 | 1802163 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 51 | 3335373 | 3335609 | + | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 52 | 1705872 | 1706111 | - | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 53 | 2446031 | 2446225 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 54 | 2430068 | 2430262 | - | NZ_CP010271.1 | Mycobacteroides saopaulense |
| 55 | 1546170 | 1546394 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 56 | 2733147 | 2733341 | - | NZ_CP014955.1 | Mycobacteroides abscessus |
| 57 | 1680826 | 1681053 | - | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 58 | 2944661 | 2944855 | - | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 59 | 1791346 | 1791573 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 60 | 6126710 | 6126937 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 61 | 2600367 | 2600606 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 62 | 2590168 | 2590380 | - | NZ_AP018165.1 | [Mycobacterium] stephanolepidis |
| 63 | 2659094 | 2659306 | - | NZ_CP007220.1 | Mycobacteroides chelonae CCUG 47445 |
| 64 | 1817956 | 1818183 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 65 | 2415843 | 2416070 | - | NZ_CP024633.1 | Mycobacteroides salmoniphilum |
| 66 | 1549192 | 1549392 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 67 | 4634867 | 4635082 | + | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 68 | 2227866 | 2228102 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 69 | 2253458 | 2253655 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 70 | 1142430 | 1142624 | - | NZ_AP022608.1 | Mycolicibacterium gadium |
| 71 | 4022405 | 4022602 | + | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 72 | 2754197 | 2754424 | + | NZ_LR134356.1 | Mycolicibacterium aurum |
| 73 | 738874 | 739116 | + | NZ_AP022603.1 | Mycolicibacterium fallax |
| 74 | 3894788 | 3894985 | + | NZ_CP043474.1 | Mycobacterium grossiae |
| 75 | 883200 | 883409 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 76 | 2615651 | 2615866 | - | NZ_CP011853.1 | Gordonia phthalatica |
| 77 | 3171889 | 3172128 | - | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 78 | 2802953 | 2803192 | + | NZ_CP027114.1 | Gordonia alkanivorans |
| 79 | 3001503 | 3001742 | + | NZ_CP059694.1 | Gordonia rubripertincta |
| 80 | 2727122 | 2727349 | - | NZ_CP027433.1 | Gordonia iterans |
| 81 | 2831058 | 2831258 | + | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 82 | 3576967 | 3577179 | - | NZ_AP023172.1 | Rhodococcus qingshengii |
| 83 | 2938381 | 2938575 | - | NZ_CP029146.1 | Rhodococcus ruber |
| 84 | 3059842 | 3060051 | + | NZ_LR134352.1 | Nocardia asteroides |
| 85 | 2837206 | 2837421 | + | NZ_AP017900.1 | Nocardia seriolae |
| 86 | 5303935 | 5304144 | - | NZ_AP023396.1 | Nocardia wallacei |
| 87 | 2005607 | 2005816 | + | NC_006361.1 | Nocardia farcinica IFM 10152 |
| 88 | 5560186 | 5560395 | - | NZ_CP026746.1 | Nocardia cyriacigeorgica |
| 89 | 2104308 | 2104517 | + | NZ_CP018082.1 | Nocardia mangyaensis |
| 90 | 2092018 | 2092236 | + | NC_014158.1 | Tsukamurella paurometabola DSM 20162 |
| 91 | 3140285 | 3140485 | - | NZ_LT906450.1 | Rhodococcus rhodochrous |
| 92 | 1584715 | 1584915 | + | NZ_CP048813.1 | Rhodococcus triatomae |
| 93 | 3796658 | 3796867 | - | NZ_CP022088.2 | Nocardia brasiliensis |
| 94 | 56881 | 57114 | + | NZ_CP011312.1 | Corynebacterium kutscheri |
| 95 | 925709 | 925945 | + | NC_012704.1 | Corynebacterium kroppenstedtii DSM 44385 |
| 96 | 2049212 | 2049418 | + | NZ_CP041695.1 | Nocardia otitidiscaviarum |
| 97 | 71112 | 71357 | + | NZ_CP011542.1 | Corynebacterium mustelae |
| 98 | 344406 | 344621 | + | NZ_CP032788.1 | Corynebacterium xerosis |
| 99 | 135662 | 135862 | + | NZ_LS483468.1 | Rhodococcus coprophilus |
| 100 | 89615 | 89833 | + | NZ_CP004353.1 | Corynebacterium vitaeruminis DSM 20294 |
| 101 | 1011409 | 1011636 | + | NC_021663.1 | Corynebacterium terpenotabidum Y-11 |
| 102 | 1858273 | 1858515 | + | NZ_LS483459.1 | Corynebacterium jeikeium |
| 103 | 2237571 | 2237795 | + | NZ_LT906481.1 | Corynebacterium urealyticum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022565.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13500.8 | 0.64 | 66 | 2203.5 | same-strand | AAA domain |
| 2 | PF04055.23 | 1.0 | 103 | 16 | same-strand | Radical SAM superfamily |
| 3 | PF06968.15 | 1.0 | 103 | 16 | same-strand | Biotin and Thiamin Synthesis associated domain |
| 4 | PF10821.10 | 0.88 | 91 | -3 | same-strand | Protein of unknown function (DUF2567) |
| 5 | PF00293.30 | 0.74 | 76 | 2076.0 | opposite-strand | NUDIX domain |
| 6 | PF19368.1 | 0.78 | 80 | 2076.0 | opposite-strand | AraR C-terminal winged HTH domain |
| 7 | PF02445.18 | 0.67 | 69 | 2811 | same-strand | Quinolinate synthetase A protein |
| 8 | PF03583.16 | 0.67 | 69 | 645 | opposite-strand | Secretory lipase |
| 9 | PF00890.26 | 0.63 | 65 | 3851.5 | same-strand | FAD binding domain |
| 10 | PF00440.25 | 0.65 | 67 | 1141.0 | opposite-strand | Bacterial regulatory proteins, tetR family |
++ More..