Result : Q48UX3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0346 protein M28_Spy0369 |
| NCBI Accession ID | |
| Organism | Streptococcus pyogenes serotype M28 (strain MGAS6180) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MRKSFYSWLMTQRNPKSNAPVAILADLVFDDTTFPKHTNDFELISRYLEDQASFSFNLGQFDEIWEDYLAHQYVDKKESYRLF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl11485. Profile Description: YozE SAM-like fold. hypothetical protein; Provisional |
| Pubmed ID | 16088825 |
| Domain | CDD:416295 |
| Functional Category | Others |
| Uniprot ID | Q48UX3 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 73100 | 73315 | - | NZ_LR134293.1 | Streptococcus canis |
| 2 | 512066 | 512281 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 3 | 440560 | 440775 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 4 | 1751136 | 1751351 | - | NZ_CP029491.1 | Streptococcus sobrinus |
| 5 | 1324323 | 1324538 | - | NZ_LS483403.1 | Streptococcus lutetiensis |
| 6 | 441160 | 441375 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 7 | 97381 | 97596 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 8 | 498452 | 498667 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 9 | 1563544 | 1563759 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 10 | 246897 | 247112 | - | NZ_CP054015.1 | Streptococcus gallolyticus |
| 11 | 501716 | 501931 | + | NZ_AP014612.1 | Streptococcus troglodytae |
| 12 | 85806 | 86021 | + | NZ_CP013237.1 | Streptococcus mutans |
| 13 | 1372785 | 1373000 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 14 | 1459881 | 1460096 | - | NZ_LR134512.1 | Streptococcus agalactiae |
| 15 | 522236 | 522451 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 16 | 1278278 | 1278493 | + | NZ_CP043405.1 | Streptococcus ratti |
| 17 | 1814671 | 1814886 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 18 | 1069661 | 1069876 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 19 | 1375517 | 1375732 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 20 | 325819 | 326034 | + | NZ_LT906439.1 | Streptococcus merionis |
| 21 | 1360630 | 1360845 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 22 | 1188973 | 1189188 | + | NZ_CP032620.1 | Streptococcus koreensis |
| 23 | 467500 | 467715 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 24 | 849795 | 850010 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 25 | 1251365 | 1251580 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 26 | 632971 | 633186 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 27 | 723516 | 723731 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 28 | 810550 | 810765 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 29 | 1459215 | 1459430 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 30 | 703558 | 703773 | + | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 31 | 1788467 | 1788682 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 32 | 977744 | 977959 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 33 | 1264805 | 1265020 | - | NC_012924.1 | Streptococcus suis SC84 |
| 34 | 1332035 | 1332250 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 35 | 1389206 | 1389415 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 36 | 735710 | 735931 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 37 | 444739 | 444948 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 38 | 427950 | 428159 | + | NZ_CP017194.1 | Lactococcus carnosus |
| 39 | 617049 | 617264 | + | NZ_CP065637.1 | Lactococcus garvieae |
| 40 | 857474 | 857695 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 41 | 1888987 | 1889208 | + | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 42 | 1909336 | 1909545 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134293.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02562.18 | 0.81 | 34 | 106.5 | same-strand | PhoH-like protein |
| 2 | PF13245.8 | 0.81 | 34 | 106.5 | same-strand | AAA domain |
| 3 | PF17783.3 | 0.76 | 32 | 587.0 | same-strand | CvfB-like winged helix domain |
| 4 | PF13509.8 | 0.79 | 33 | 587 | same-strand | S1 domain |
| 5 | PF01765.21 | 0.76 | 32 | 1599.0 | same-strand | Ribosome recycling factor |
| 6 | PF00696.30 | 0.71 | 30 | 2206.5 | same-strand | Amino acid kinase family |
++ More..