Result : Q48RX4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0291 protein M28_Spy1426 |
| NCBI Accession ID | CP000056.2 |
| Organism | Streptococcus pyogenes serotype M28 (strain MGAS6180) |
| Left | 1425502 |
| Right | 1425759 |
| Strand | - |
| Nucleotide Sequence | ATGGATCCTAAAAAAATTGCTCGTATCAATGAGCTGGCTAAAAAGAAAAAAACGGTAGGCTTGACTGGACCTGAAAAAGTGGAACAGGCAAAACTCCGTGAAGAATACATTGAAGGCTATCGTCGCTCTGTCAGACACCATATCGAAGGCATCAAATTGGTGGACGAAGAAGGAAACGACGTGACCCCTGAAAAATTAAGACAGGTGCAACGTGAAAAAGGCTTGCACGGCCGTTCATTAGATGACCCAAAATCATAA |
| Sequence | MDPKKIARINELAKKKKTVGLTGPEKVEQAKLREEYIEGYRRSVRHHIEGIKLVDEEGNDVTPEKLRQVQREKGLHGRSLDDPKS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01722. Profile Description: Bacterial protein of unknown function (DUF896). hypothetical protein; Provisional |
| Pubmed ID | 16088825 |
| Domain | CDD:413030 |
| Functional Category | Others |
| Uniprot ID | Q48RX4 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 140
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1049192 | 1049449 | + | NZ_LR134293.1 | Streptococcus canis |
| 2 | 1695271 | 1695528 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 3 | 1297130 | 1297387 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 4 | 1546317 | 1546574 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 5 | 1383380 | 1383637 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 6 | 274790 | 275047 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 7 | 506252 | 506509 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 8 | 1566455 | 1566712 | - | NZ_LR594050.1 | Streptococcus porcinus |
| 9 | 371831 | 372088 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 10 | 371214 | 371471 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 11 | 596330 | 596587 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 12 | 622003 | 622260 | + | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 13 | 1621500 | 1621757 | + | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 14 | 313509 | 313766 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 15 | 356756 | 357013 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 16 | 1602748 | 1603005 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 17 | 365256 | 365513 | + | NZ_LS483436.1 | Streptococcus intermedius |
| 18 | 514657 | 514914 | + | NZ_LR134275.1 | Streptococcus vestibularis |
| 19 | 504674 | 504931 | + | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 20 | 112132 | 112389 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 21 | 291914 | 292171 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 22 | 2001763 | 2002020 | + | NZ_CP014835.1 | Streptococcus halotolerans |
| 23 | 399766 | 400023 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 24 | 1180774 | 1181031 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 25 | 367261 | 367518 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 26 | 1632306 | 1632563 | - | NZ_AP018400.1 | Streptococcus ruminantium |
| 27 | 1970186 | 1970443 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 28 | 340091 | 340348 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 29 | 1662950 | 1663207 | - | NC_012924.1 | Streptococcus suis SC84 |
| 30 | 818564 | 818821 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 31 | 274016 | 274273 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 32 | 110242 | 110499 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 33 | 394468 | 394722 | + | NZ_LS483343.1 | Streptococcus ferus |
| 34 | 1104628 | 1104882 | + | NZ_CP043405.1 | Streptococcus ratti |
| 35 | 1786349 | 1786603 | - | NZ_LT906439.1 | Streptococcus merionis |
| 36 | 1203869 | 1204123 | - | NZ_CP013237.1 | Streptococcus mutans |
| 37 | 2165805 | 2166059 | - | NZ_CP023011.2 | Enterococcus hirae |
| 38 | 1546355 | 1546594 | - | NZ_CP023074.1 | Enterococcus thailandicus |
| 39 | 1341658 | 1341909 | + | NZ_CP065211.1 | Enterococcus lactis |
| 40 | 1676280 | 1676531 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 41 | 671771 | 672013 | + | NZ_CP017267.1 | Vagococcus teuberi |
| 42 | 2169848 | 2170090 | + | NZ_CP049887.1 | Vagococcus hydrophili |
| 43 | 1811297 | 1811536 | - | NC_020995.1 | Enterococcus casseliflavus EC20 |
| 44 | 2070226 | 2070468 | - | NZ_CP060720.1 | Vagococcus carniphilus |
| 45 | 1330412 | 1330654 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 46 | 1264883 | 1265089 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 47 | 1413641 | 1413883 | - | NZ_AP022822.1 | Enterococcus saigonensis |
| 48 | 1219267 | 1219518 | + | NZ_CP018061.1 | Enterococcus mundtii |
| 49 | 902737 | 902970 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 50 | 1141462 | 1141701 | + | NZ_LS483306.1 | Enterococcus cecorum |
| 51 | 1860034 | 1860276 | + | NZ_CP023392.1 | Lactococcus raffinolactis |
| 52 | 603576 | 603800 | + | NZ_CP021874.1 | Enterococcus wangshanyuanii |
| 53 | 1410031 | 1410270 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 54 | 1214689 | 1214910 | - | NZ_CP049886.1 | Vagococcus coleopterorum |
| 55 | 1821405 | 1821656 | + | NZ_CP053988.1 | Abiotrophia defectiva |
| 56 | 545196 | 545411 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 57 | 1816353 | 1816589 | + | NZ_CP027770.1 | Staphylococcus felis |
| 58 | 2087038 | 2087271 | - | NZ_CP011937.1 | Bacillus velezensis |
| 59 | 1868563 | 1868796 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 60 | 2346422 | 2346658 | + | NZ_CP020773.1 | Staphylococcus lutrae |
| 61 | 1978744 | 1978977 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 62 | 2029330 | 2029563 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 63 | 3140957 | 3141193 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 64 | 1723166 | 1723399 | - | NZ_CP012024.1 | Bacillus smithii |
| 65 | 1769111 | 1769341 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 66 | 1948371 | 1948604 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 67 | 1409501 | 1409737 | - | NZ_LT906462.1 | Mammaliicoccus stepanovicii |
| 68 | 1827776 | 1828009 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 69 | 1919459 | 1919692 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 70 | 1883347 | 1883580 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 71 | 1129822 | 1130058 | + | NC_014925.1 | Staphylococcus pseudintermedius HKU10-03 |
| 72 | 2013264 | 2013494 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 73 | 1552794 | 1553033 | - | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 74 | 2032444 | 2032677 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 75 | 2430475 | 2430708 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 76 | 655671 | 655904 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 77 | 2161956 | 2162189 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 78 | 1023228 | 1023449 | - | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 79 | 1614964 | 1615194 | - | NZ_AP018587.1 | Staphylococcus caprae |
| 80 | 16311 | 16541 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 81 | 1838390 | 1838614 | + | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 82 | 1355318 | 1355548 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 83 | 805049 | 805279 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 84 | 3546453 | 3546683 | - | NZ_CP043404.1 | Bacillus safensis |
| 85 | 1822719 | 1822964 | + | NZ_CP066042.1 | Staphylococcus saccharolyticus |
| 86 | 1115233 | 1115451 | + | NZ_CP047361.1 | Macrococcus canis |
| 87 | 597020 | 597238 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 88 | 445550 | 445780 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 89 | 4521481 | 4521714 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 90 | 652409 | 652645 | + | NZ_CP007601.1 | Staphylococcus capitis subsp. capitis |
| 91 | 2627464 | 2627694 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 92 | 1299218 | 1299454 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 93 | 1675750 | 1675983 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 94 | 1552163 | 1552399 | - | NZ_CP035288.1 | Staphylococcus epidermidis |
| 95 | 2206410 | 2206649 | - | NZ_CP033732.1 | Staphylococcus hominis |
| 96 | 1846666 | 1846899 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 97 | 1089131 | 1089367 | - | NZ_CP061835.1 | Weissella viridescens |
| 98 | 2427487 | 2427720 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 99 | 1050998 | 1051237 | + | NZ_CP012047.1 | Tetragenococcus halophilus |
| 100 | 50702 | 50935 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 101 | 3556459 | 3556689 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 102 | 1498392 | 1498628 | - | NZ_LR134242.1 | Staphylococcus warneri |
| 103 | 2487225 | 2487461 | + | NC_022737.1 | Staphylococcus pasteuri SP1 |
| 104 | 988159 | 988395 | + | NZ_CP045927.1 | Staphylococcus agnetis |
| 105 | 1881541 | 1881774 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 106 | 1568580 | 1568816 | - | NZ_CP008747.1 | Staphylococcus hyicus |
| 107 | 2559502 | 2559735 | + | NZ_CP053989.1 | Niallia circulans |
| 108 | 3070188 | 3070418 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 109 | 867429 | 867635 | - | NZ_CP017326.1 | Weissella soli |
| 110 | 427385 | 427600 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 111 | 1935819 | 1936079 | + | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 112 | 801657 | 801896 | - | NZ_CP018199.1 | Staphylococcus succinus |
| 113 | 2471186 | 2471425 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 114 | 2203257 | 2203490 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 115 | 1515385 | 1515624 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 116 | 1241512 | 1241739 | + | NC_013891.1 | Listeria seeligeri serovar 1/2b str. SLCC3954 |
| 117 | 1231929 | 1232147 | + | NZ_CP054482.1 | Macrococcus bohemicus |
| 118 | 2407442 | 2407675 | - | NZ_LS483476.1 | Lederbergia lentus |
| 119 | 1147782 | 1148018 | + | NC_010556.1 | Exiguobacterium sibiricum 255-15 |
| 120 | 1405948 | 1406196 | - | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 121 | 722146 | 722397 | + | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 122 | 577685 | 577939 | + | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 123 | 1056438 | 1056656 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 124 | 1393234 | 1393467 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 125 | 1089016 | 1089252 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 126 | 4787194 | 4787424 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 127 | 1900892 | 1901134 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 128 | 882162 | 882395 | - | NZ_CP023501.1 | Weissella paramesenteroides |
| 129 | 933640 | 933873 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 130 | 2106916 | 2107155 | - | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 131 | 725918 | 726169 | + | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 132 | 2546755 | 2546985 | + | NZ_CP014912.1 | Secundilactobacillus paracollinoides |
| 133 | 1434475 | 1434717 | + | NZ_CP033460.1 | Staphylococcus debuckii |
| 134 | 754269 | 754490 | + | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 135 | 3532763 | 3533005 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 136 | 1862302 | 1862526 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 137 | 751589 | 751831 | + | NZ_CP032627.1 | Lactococcus allomyrinae |
| 138 | 97667 | 97888 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 139 | 1415895 | 1416125 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 140 | 5230929 | 5231135 | - | NZ_CP041217.1 | Saccharibacillus brassicae |
| 141 | 292996 | 293247 | + | NZ_CP022096.2 | Staphylococcus pettenkoferi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP023011.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00717.25 | 0.69 | 96 | 555.0 | opposite-strand | Peptidase S24-like |
| 2 | PF01726.18 | 0.69 | 96 | 555.0 | opposite-strand | LexA DNA binding domain |
++ More..