Result : Q48509
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Bacteriocin lactacin-F subunit LafX |
| NCBI Accession ID | M57961.1 |
| Organism | Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) |
| Left | 932 |
| Right | 1120 |
| Strand | + |
| Nucleotide Sequence | ATGAAATTAAATGACAAAGAATTATCAAAGATTGTTGGTGGAAATCGATGGGGAGATACTGTTTTATCAGCTGCTAGTGGCGCAGGAACTGGTATTAAAGCATGTAAAAGTTTTGGCCCATGGGGAATGGCAATTTGTGGTGTAGGAGGTGCAGCAATAGGAGGTTATTTTGGCTATACTCATAATTAA |
| Sequence | MKLNDKELSKIVGGNRWGDTVLSAASGAGTGIKACKSFGPWGMAICGVGGAAIGGYFGYTHN |
| Source of smORF | Swiss-Prot |
| Function | Heat stable bacteriocin active against Enterococcus faecalis and other Lactobacilli. |
| Pubmed ID | 8285694 14983040 |
| Domain | |
| Functional Category | Antimicrobial |
| Uniprot ID | Q48509 |
| ORF Length (Amino Acid) | 62 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 624519 | 624707 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 2 | 602727 | 602882 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP059276.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14501.8 | 1.0 | 2 | 3941 | same-strand | GHKL domain |
| 2 | PF04397.17 | 1.0 | 2 | 3249.0 | same-strand | LytTr DNA-binding domain |
| 3 | PF00072.26 | 1.0 | 2 | 3249.0 | same-strand | Response regulator receiver domain |
| 4 | PF00664.25 | 1.0 | 2 | 1077.0 | same-strand | ABC transporter transmembrane region |
| 5 | PF03412.17 | 1.0 | 2 | 1077.0 | same-strand | Peptidase C39 family |
| 6 | PF00005.29 | 1.0 | 2 | 1077.0 | same-strand | ABC transporter |
| 7 | PF13437.8 | 1.0 | 2 | 473.0 | same-strand | HlyD family secretion protein |
| 8 | PF10439.11 | 1.0 | 2 | 52 | same-strand | Bacteriocin class II with double-glycine leader peptide |
| 9 | PF17608.4 | 1.0 | 2 | 51.5 | same-strand | Family of unknown function (DUF5504) |
++ More..