| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | CP000083.1 |
| Organism | Colwellia psychrerythraea (strain 34H / ATCC BAA-681) (Vibrio psychroerythus) |
| Left | 4689764 |
| Right | 4690000 |
| Strand | + |
| Nucleotide Sequence | ATGACCTTAAAAGTTCCTTGTCCACAATGTCAAAAAACTGTTGTATGGCAAGCAAGTAGCGAATTTAGACCTTTCTGTAGTAAACGCTGTCAGCTCATTGATCTTGGAGAATGGGCAGAAGAAAGTCATAAAATCAGCCAAAACATTCAAGTTGATACTGTTTTATCAGAAGAAATGTTGGATGCGATGGAAGATGAATTTTTACTTAACAACAAATTTTTTGTTGAGCCCGAATAA |
| Sequence | MTLKVPCPQCQKTVVWQASSEFRPFCSKRCQLIDLGEWAEESHKISQNIQVDTVLSEEMLDAMEDEFLLNNKFFVEPE |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | 16043709 |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | Q47VS2 |
| ORF Length (Amino Acid) | 78 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4689764 | 4690000 | + | NC_003910.7 | Colwellia psychrerythraea 34H |
| 2 | 3191289 | 3191525 | - | NZ_CP034759.1 | Litorilituus sediminis |
| 3 | 105014 | 105250 | - | NZ_CP020465.1 | Cognaticolwellia beringensis |
| 4 | 629595 | 629831 | - | NZ_CP017689.1 | Thalassotalea crassostreae |
| 5 | 3013860 | 3014093 | + | NZ_CP009888.1 | Pseudoalteromonas piratica |
| 6 | 377398 | 377613 | - | NZ_CP069213.1 | Shewanella litorisediminis |
| 7 | 4599187 | 4599402 | - | NZ_CP020373.1 | Shewanella khirikhana |
| 8 | 2748916 | 2749146 | - | NZ_CP072844.1 | Psychrosphaera aestuarii |
| 9 | 442313 | 442528 | - | NC_008700.1 | Shewanella amazonensis SB2B |
| 10 | 712876 | 713118 | + | NZ_CP072425.1 | Pseudoalteromonas viridis |
| 11 | 530447 | 530674 | - | NC_015554.1 | Alteromonas naphthalenivorans |
| 12 | 501446 | 501658 | - | NZ_CP009056.1 | Frischella perrara |
| 13 | 512773 | 512985 | - | NC_009831.1 | Shewanella sediminis HAW-EB3 |
| 14 | 2359680 | 2359910 | - | NZ_CP019628.1 | Pseudoalteromonas aliena |
| 15 | 871200 | 871430 | + | NZ_CP052766.1 | Alteromonas pelagimontana |
| 16 | 2979862 | 2980092 | + | NZ_CP011041.1 | Pseudoalteromonas tetraodonis |
| 17 | 3426787 | 3427017 | + | NZ_CP011025.1 | Pseudoalteromonas arctica A 37-1-2 |
| 18 | 3549656 | 3549883 | + | NZ_CP014322.1 | Alteromonas addita |
| 19 | 3838625 | 3838837 | + | NZ_CP022272.1 | Shewanella marisflavi |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00437.22 | 0.84 | 16 | 3724 | same-strand | Type II/IV secretion system protein |
| 2 | PF05157.17 | 0.79 | 15 | 3729.5 | same-strand | Type II secretion system (T2SS), protein E, N-terminal domain |
| 3 | PF00482.25 | 1.0 | 19 | 2637 | same-strand | Type II secretion system (T2SS), protein F |
| 4 | PF06750.15 | 1.0 | 19 | 1679 | same-strand | Bacterial Peptidase A24 N-terminal domain |
| 5 | PF01478.20 | 1.0 | 19 | 1679 | same-strand | Type IV leader peptidase family |
| 6 | PF01121.22 | 1.0 | 19 | 923 | same-strand | Dephospho-CoA kinase |
| 7 | PF07072.13 | 0.74 | 14 | 62.5 | same-strand | Cell division protein |
| 8 | PF14815.8 | 0.63 | 12 | 42.0 | opposite-strand | NUDIX domain |