Result : Q47BJ2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP000089.1 |
| Organism | Dechloromonas aromatica (strain RCB) |
| Left | 3302530 |
| Right | 3302769 |
| Strand | + |
| Nucleotide Sequence | ATGGACCAAACGCCCATCGCCGACATGAAATTCGAGACGGCGCTCGCCGAACTCGAGGACATCGTCGCCAGCATGGAAGGCGGCAAGCTTGAACTCGAAGCTTCCATCGCCGCCTACAAGCGCGGCATGGAGCTGATGAAGCACTGCCAGAACCAGCTCGCCGATGCCGAAGCGCAGATTCGCGTGCTCGAAAACGGCCAGTTCAAGGATGTCGACCGCAGCACTCTGGAGGCCCAGTGA |
| Sequence | MDQTPIADMKFETALAELEDIVASMEGGKLELEASIAAYKRGMELMKHCQNQLADAEAQIRVLENGQFKDVDRSTLEAQ |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | 19650930 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q47BJ2 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3603550 | 3603804 | + | NZ_CP064781.1 | Azospira restricta |
| 2 | 4049180 | 4049413 | + | NZ_CP039731.1 | Aquitalea aquatilis |
| 3 | 1255401 | 1255634 | - | NZ_CP047241.1 | Aquitalea denitrificans |
| 4 | 996878 | 997120 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 5 | 1542492 | 1542746 | + | NZ_CP013341.1 | Nitrosomonas ureae |
| 6 | 1776406 | 1776639 | - | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 7 | 705627 | 705872 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 8 | 505921 | 506166 | - | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 9 | 3208904 | 3209125 | - | NC_010170.1 | Bordetella petrii |
| 10 | 840548 | 840787 | + | NZ_CP013403.1 | Burkholderia metallica |
| 11 | 905078 | 905305 | + | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 12 | 4793998 | 4794195 | + | NZ_CP046904.1 | Massilia flava |
| 13 | 3921364 | 3921561 | - | NZ_CP016171.1 | Bordetella bronchialis |
| 14 | 1721436 | 1721672 | + | NZ_LT907988.1 | Orrella dioscoreae |
| 15 | 1618220 | 1618459 | - | NZ_CP009793.1 | Burkholderia dolosa AU0158 |
| 16 | 3529276 | 3529515 | - | NZ_CP053073.1 | Usitatibacter palustris |
| 17 | 815661 | 815924 | + | NZ_CP013236.1 | Collimonas pratensis |
| 18 | 1074582 | 1074848 | + | NZ_CP013232.1 | Collimonas fungivorans |
| 19 | 934519 | 934740 | + | NZ_CP013452.1 | Burkholderia cenocepacia |
| 20 | 205735 | 205956 | - | NZ_CP011504.1 | Burkholderia pyrrocinia |
| 21 | 688693 | 688959 | + | NZ_CP013235.1 | Collimonas arenae |
| 22 | 725311 | 725538 | + | NZ_CP009831.1 | Burkholderia multivorans ATCC BAA-247 |
| 23 | 1789336 | 1789557 | - | NZ_CP009728.1 | Burkholderia mallei |
| 24 | 262842 | 263063 | + | NZ_CP008782.1 | Burkholderia pseudomallei |
| 25 | 2702514 | 2702750 | - | NZ_CP043146.1 | Bordetella holmesii |
| 26 | 716032 | 716253 | + | NC_007650.1 | Burkholderia thailandensis E264 |
| 27 | 2070757 | 2070960 | - | NZ_LT671418.1 | Herminiimonas arsenitoxidans |
| 28 | 1634753 | 1634989 | + | NZ_CP016440.1 | Bordetella pseudohinzii |
| 29 | 2025565 | 2025795 | + | NZ_CP016172.1 | Bordetella flabilis |
| 30 | 3046927 | 3047130 | - | NZ_CP034464.1 | Undibacterium parvum |
| 31 | 5992517 | 5992714 | + | NZ_CP040017.1 | Massilia umbonata |
| 32 | 1532234 | 1532428 | + | NZ_CP028324.1 | Massilia armeniaca |
| 33 | 1740074 | 1740271 | + | NZ_CP049135.1 | Paraburkholderia tropica |
| 34 | 1063202 | 1063423 | + | NZ_CP020738.1 | Paraburkholderia acidophila |
| 35 | 282326 | 282565 | - | NZ_CP012908.1 | Ketogulonicigenium vulgare |
| 36 | 793097 | 793318 | + | NZ_CP013416.1 | Burkholderia ubonensis |
| 37 | 2264979 | 2265182 | - | NZ_CP054626.1 | Cupriavidus gilardii |
| 38 | 1654358 | 1654558 | - | NZ_CP022987.1 | Pusillimonas thiosulfatoxidans |
| 39 | 174335 | 174574 | - | NZ_CP019937.1 | Ketogulonicigenium robustum |
| 40 | 2186041 | 2186286 | + | NZ_CP061498.1 | Roseicitreum antarcticum |
| 41 | 1233867 | 1234076 | - | NC_021294.1 | Caballeronia insecticola |
| 42 | 2717148 | 2717348 | + | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 43 | 1223954 | 1224202 | + | NZ_CP016616.1 | Microvirga ossetica |
| 44 | 1351552 | 1351800 | - | NZ_CP045423.1 | Microvirga thermotolerans |
| 45 | 723358 | 723576 | - | NZ_CP019044.1 | Salaquimonas pukyongi |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP064781.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00848.21 | 0.76 | 34 | 343.0 | opposite-strand | Ring hydroxylating alpha subunit (catalytic domain) |
| 2 | PF00355.28 | 0.69 | 31 | 343 | opposite-strand | Rieske [2Fe-2S] domain |
| 3 | PF00348.19 | 0.93 | 42 | -3.0 | same-strand | Polyprenyl synthetase |
| 4 | PF13292.8 | 0.98 | 44 | 952.0 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 5 | PF02779.26 | 0.98 | 44 | 952.0 | same-strand | Transketolase, pyrimidine binding domain |
| 6 | PF02780.22 | 0.98 | 44 | 952.0 | same-strand | Transketolase, C-terminal domain |
| 7 | PF02649.16 | 0.69 | 31 | 3015 | same-strand | Type I GTP cyclohydrolase folE2 |
++ More..