Result : A8ESV4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L24 |
| NCBI Accession ID | CP000361.1 |
| Organism | Arcobacter butzleri (strain RM4018) |
| Left | 767188 |
| Right | 767427 |
| Strand | + |
| Nucleotide Sequence | ATGGCAATTAAATTAAAAATTAAAAAAGGTGATACTGTAAAAATCATCGCTGGTGATGATAAAGGTAAAACTGGAGAAGTTTTAGCTGTATTACCAAAAGAAAAAAAAGTAATCGTTAAAGATTGCAAAGTTGCTAAAAAAACTGTTAAACCTGATCAAGAAAAAAATCCAGAAGGTGGATTTGTAAACAAAGAAATGCCAATTGATATTTCAAATGTAGCAAAAGTAGAAGGTGAGTAA |
| Sequence | MAIKLKIKKGDTVKIIAGDDKGKTGEVLAVLPKEKKVIVKDCKVAKKTVKPDQEKNPEGGFVNKEMPIDISNVAKVEGE |
| Source of smORF | Swiss-Prot |
| Function | One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit. {ECO:0000255|HAMAP-Rule:MF_01326}.; One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit. {ECO:0000255|HAMAP-Rule:MF_01326}. |
| Pubmed ID | 18159241 |
| Domain | CDD:412330,CDD:128978 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A8ESV4 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 98
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 728556 | 728795 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 2 | 890091 | 890330 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 3 | 912378 | 912617 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 4 | 676137 | 676376 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 5 | 878727 | 878966 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 6 | 939027 | 939266 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 7 | 1611966 | 1612202 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 8 | 976176 | 976415 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 9 | 1060314 | 1060553 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 10 | 1481031 | 1481267 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 11 | 727568 | 727804 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 12 | 815475 | 815714 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 13 | 870258 | 870497 | + | NZ_CP053833.1 | Arcobacter cloacae |
| 14 | 640829 | 641065 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 15 | 975899 | 976138 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 16 | 946901 | 947140 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 17 | 953116 | 953355 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 18 | 932758 | 932997 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 19 | 936520 | 936759 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 20 | 612039 | 612275 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 21 | 573252 | 573488 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 22 | 950925 | 951164 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 23 | 1088762 | 1089001 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 24 | 787934 | 788167 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 25 | 845098 | 845334 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 26 | 1575890 | 1576117 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 27 | 1615195 | 1615428 | - | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 28 | 1250065 | 1250298 | + | NZ_CP031611.1 | Campylobacter hepaticus |
| 29 | 1866781 | 1867014 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 30 | 2020461 | 2020697 | - | NZ_CP012544.1 | Campylobacter showae |
| 31 | 69257 | 69493 | + | NZ_CP012543.1 | Campylobacter rectus |
| 32 | 1736103 | 1736339 | - | NZ_CP012541.1 | Campylobacter concisus |
| 33 | 92726 | 92959 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 34 | 159799 | 160041 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 35 | 186684 | 186917 | + | NZ_CP012196.1 | Campylobacter gracilis |
| 36 | 38746 | 38979 | + | NZ_CP059443.1 | Campylobacter fetus |
| 37 | 16105 | 16338 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 38 | 1685965 | 1686195 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 39 | 60105 | 60326 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 40 | 1850090 | 1850329 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 41 | 1526393 | 1526626 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 42 | 104602 | 104835 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 43 | 59120 | 59320 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 44 | 1670446 | 1670676 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 45 | 1352666 | 1352902 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 46 | 62150 | 62350 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 47 | 71272 | 71472 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 48 | 695462 | 695662 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 49 | 64531 | 64731 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 50 | 106055 | 106288 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 51 | 33293 | 33493 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 52 | 110312 | 110548 | + | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 53 | 62771 | 62971 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 54 | 1831433 | 1831669 | - | NZ_CP053826.1 | Campylobacter curvus |
| 55 | 1781965 | 1782198 | - | NZ_CP053841.1 | Campylobacter blaseri |
| 56 | 1980955 | 1981191 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 57 | 2047024 | 2047260 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 58 | 2140021 | 2140254 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 59 | 1611613 | 1611843 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 60 | 1612049 | 1612270 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 61 | 1590028 | 1590264 | - | NZ_CP053842.1 | Campylobacter corcagiensis |
| 62 | 424995 | 425231 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 63 | 156270 | 156503 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 64 | 2436218 | 2436454 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 65 | 2593755 | 2593991 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 66 | 197665 | 197898 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 67 | 662381 | 662587 | + | NZ_CP014991.1 | Helicobacter himalayensis |
| 68 | 586959 | 587162 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 69 | 1172597 | 1172800 | - | NZ_LS483446.1 | Helicobacter mustelae |
| 70 | 1335264 | 1335467 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 71 | 308576 | 308806 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 72 | 1585620 | 1585871 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 73 | 1393309 | 1393509 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 74 | 1267933 | 1268136 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 75 | 174330 | 174530 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 76 | 346456 | 346707 | + | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 77 | 68778 | 68978 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 78 | 216461 | 216661 | + | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 79 | 1529128 | 1529379 | - | NC_012115.1 | Nautilia profundicola AmH |
| 80 | 842037 | 842258 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 81 | 1301620 | 1301853 | - | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 82 | 1361730 | 1361951 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 83 | 129934 | 130155 | + | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 84 | 241980 | 242174 | + | NZ_CP029844.1 | Blattabacterium clevelandi |
| 85 | 893457 | 893684 | - | NZ_AP021898.1 | Akkermansia muciniphila |
| 86 | 1710683 | 1710925 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 87 | 2094505 | 2094747 | - | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 88 | 2020091 | 2020333 | - | NZ_CP040736.1 | Companilactobacillus futsaii |
| 89 | 3269619 | 3269870 | - | NC_006177.1 | Symbiobacterium thermophilum IAM 14863 |
| 90 | 343198 | 343437 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 91 | 338493 | 338732 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 92 | 341440 | 341679 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 93 | 1276898 | 1277149 | - | NZ_CP029476.1 | Lactobacillus apis |
| 94 | 275210 | 275443 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 95 | 399072 | 399305 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 96 | 296077 | 296310 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 97 | 1545495 | 1545728 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 98 | 359296 | 359529 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017187.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00189.22 | 0.99 | 97 | 1238 | same-strand | Ribosomal protein S3, C-terminal domain |
| 2 | PF07650.19 | 0.99 | 97 | 1238 | same-strand | KH domain |
| 3 | PF00252.20 | 0.99 | 97 | 810 | same-strand | Ribosomal protein L16p/L10e |
| 4 | PF00831.25 | 0.99 | 97 | 633 | same-strand | Ribosomal L29 protein |
| 5 | PF00366.22 | 0.99 | 97 | 370 | same-strand | Ribosomal protein S17 |
| 6 | PF00238.21 | 0.99 | 97 | 0 | same-strand | Ribosomal protein L14p/L23e |
| 7 | PF00673.23 | 1.0 | 98 | 3.5 | same-strand | ribosomal L5P family C-terminus |
| 8 | PF00281.21 | 1.0 | 98 | 3.5 | same-strand | Ribosomal protein L5 |
| 9 | PF00253.23 | 0.84 | 82 | 550.5 | same-strand | Ribosomal protein S14p/S29e |
| 10 | PF00410.21 | 1.0 | 98 | 748.5 | same-strand | Ribosomal protein S8 |
| 11 | PF00347.25 | 1.0 | 98 | 1202.0 | same-strand | Ribosomal protein L6 |
| 12 | PF00861.24 | 1.0 | 98 | 1754.5 | same-strand | Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast |
++ More..