Result : Q478W6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0235 protein Daro_3887 |
| NCBI Accession ID | CP000089.1 |
| Organism | Dechloromonas aromatica (strain RCB) |
| Left | 4179805 |
| Right | 4180098 |
| Strand | + |
| Nucleotide Sequence | GTGAGTGACTGGTTCCGTCAGGCAGCCAATGGCTGCATCACACTGACCCTGCACATCCAGCCCGGCGCGAAGAAATCGGAATTCGCCGGGCTGCATGGCGATGCCCTGAAAATCCGCCTCGCCGCACCGCCCGTCGATGGCAAGGCCAACGAGGCGCTGATCAGATTCATCGCCGACGCACTGGGACTAGCCAAATCGGCGGTCCATCTGAAGAGTGGCCAAACCTCGCGGCGCAAGGTGCTGGAAATCCTTGGCACCAGTACCACGACTATCGCTGGACTGGCTGATCGATAA |
| Sequence | MSDWFRQAANGCITLTLHIQPGAKKSEFAGLHGDALKIRLAAPPVDGKANEALIRFIADALGLAKSAVHLKSGQTSRRKVLEILGTSTTTIAGLADR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
| Pubmed ID | 19650930 |
| Domain | CDD:412584 |
| Functional Category | Others |
| Uniprot ID | Q478W6 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 46
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 501381 | 501683 | + | NZ_CP064781.1 | Azospira restricta |
| 2 | 3290020 | 3290271 | - | NZ_CP022579.1 | Oryzomicrobium terrae |
| 3 | 3888325 | 3888621 | - | NZ_CP016210.1 | Azoarcus olearius |
| 4 | 1925090 | 1925347 | - | NZ_CP059560.1 | Aromatoleum petrolei |
| 5 | 2653710 | 2654003 | + | NZ_CP059467.1 | Aromatoleum bremense |
| 6 | 1030084 | 1030377 | - | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 7 | 2551876 | 2552163 | - | NZ_CP058952.1 | Chitinibacter fontanus |
| 8 | 268065 | 268328 | - | NZ_AP012547.1 | Sulfuritalea hydrogenivorans sk43H |
| 9 | 2783642 | 2783926 | - | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 10 | 262465 | 262764 | - | NZ_AP018738.1 | Ferriphaselus amnicola |
| 11 | 216853 | 217170 | - | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 12 | 1642711 | 1642995 | - | NZ_CP041335.1 | Chitinolyticbacter meiyuanensis |
| 13 | 3484164 | 3484460 | + | NZ_CP017707.1 | Chromobacterium vaccinii |
| 14 | 688044 | 688301 | - | NZ_AP022345.1 | Fluviibacter phosphoraccumulans |
| 15 | 2585445 | 2585744 | + | NZ_AP018721.1 | Sulfuritortus calidifontis |
| 16 | 79678 | 79977 | - | NC_022357.1 | Sulfuricella denitrificans skB26 |
| 17 | 2718732 | 2719019 | - | NZ_CP010554.1 | Rugosibacter aromaticivorans |
| 18 | 1413092 | 1413391 | - | NZ_CP011451.1 | Nitrosomonas communis |
| 19 | 246310 | 246645 | - | NZ_AP018786.1 | Sutterella megalosphaeroides |
| 20 | 664492 | 664809 | - | NC_007614.1 | Nitrosospira multiformis ATCC 25196 |
| 21 | 1140591 | 1140908 | - | NZ_CP021106.3 | Nitrosospira lacus |
| 22 | 1510580 | 1510876 | + | NZ_CP039731.1 | Aquitalea aquatilis |
| 23 | 277939 | 278235 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 24 | 2096374 | 2096613 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 25 | 488563 | 488865 | - | NZ_AP019755.1 | Nitrosomonas stercoris |
| 26 | 293714 | 294010 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 27 | 851801 | 852109 | - | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
| 28 | 2789868 | 2790155 | - | NZ_CP014205.2 | Pseudomonas glycinae |
| 29 | 503691 | 503981 | - | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 30 | 862549 | 862845 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 31 | 308794 | 309093 | + | NZ_AP017928.1 | Methylocaldum marinum |
| 32 | 6132384 | 6132644 | + | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 33 | 811563 | 811853 | - | NZ_CP060009.1 | Pseudomonas sediminis |
| 34 | 4012000 | 4012296 | + | NZ_CP043473.1 | Chromobacterium paludis |
| 35 | 3848563 | 3848805 | - | NZ_CP011801.1 | Nitrospira moscoviensis |
| 36 | 4611880 | 4612170 | - | NZ_CP048810.1 | Pseudomonas bijieensis |
| 37 | 6132347 | 6132637 | + | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 38 | 360563 | 360859 | + | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 39 | 6345598 | 6345891 | + | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 40 | 4024883 | 4025179 | - | NZ_CP047241.1 | Aquitalea denitrificans |
| 41 | 2130065 | 2130361 | + | NZ_CP029495.1 | Chromobacterium phragmitis |
| 42 | 6396868 | 6397161 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 43 | 4588140 | 4588436 | - | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 44 | 5293225 | 5293482 | - | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 45 | 4818895 | 4819188 | - | NZ_CP012676.1 | Pseudomonas versuta |
| 46 | 2901628 | 2901918 | - | NZ_CP013341.1 | Nitrosomonas ureae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP064781.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00437.22 | 0.61 | 28 | 2229.0 | opposite-strand | Type II/IV secretion system protein |
| 2 | PF01168.22 | 0.61 | 28 | 1449.0 | same-strand | Alanine racemase, N-terminal domain |
| 3 | PF14748.8 | 0.76 | 35 | 606 | same-strand | Pyrroline-5-carboxylate reductase dimerisation |
| 4 | PF03807.19 | 0.76 | 35 | 607.5 | same-strand | NADP oxidoreductase coenzyme F420-dependent |
| 5 | PF02325.19 | 0.76 | 35 | 4 | same-strand | YGGT family |
++ More..