| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Copper chaperone CopZ (Activator of copYZAB) |
| NCBI Accession ID | Z46807.1 |
| Organism | Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) |
| Left | 1713 |
| Right | 1922 |
| Strand | + |
| Nucleotide Sequence | ATGAAACAAGAATTTTCAGTTAAAGGGATGAGTTGCAACCATTGTGTGGCTCGGATTGAAGAAGCGGTCGGAAGAATCAGTGGTGTCAAAAAAGTAAAAGTTCAGCTGAAAAAAGAAAAAGCCGTTGTGAAATTTGATGAAGCAAATGTTCAAGCGACAGAGATTTGTCAAGCAATCAATGAATTAGGCTATCAAGCAGAGGTGATTTGA |
| Sequence | MKQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI |
| Source of smORF | Swiss-Prot |
| Function | Acts as a copper chaperone by delivering 2 Cu(+) ions to CopY Zn(2+)-bound form. This transfer results in displacement of zinc and dissociation of CopY from the promoter, allowing transcription of the copYZAB operon. {ECO:0000269|Pubmed:10069368, ECO:0000269|Pubmed:11980486, ECO:0000269|Pubmed:7876197}. |
| Pubmed ID | 7876197 22933757 10362527 10069368 11585824 11594769 11980486 10428839 |
| Domain | CDD:412222 |
| Functional Category | Metal-binding |
| Uniprot ID | Q47840 |
| ORF Length (Amino Acid) | 69 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1553821 | 1554030 | + | NZ_CP023011.2 | Enterococcus hirae |
| 2 | 964752 | 964961 | + | NZ_CP065211.1 | Enterococcus lactis |
| 3 | 888971 | 889180 | + | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
| 4 | 1973371 | 1973580 | - | NZ_CP018061.1 | Enterococcus mundtii |
| 5 | 720948 | 721160 | + | NZ_CP023074.1 | Enterococcus thailandicus |
| 6 | 1749770 | 1749979 | - | NZ_CP012047.1 | Tetragenococcus halophilus |
| 7 | 971755 | 971961 | + | NZ_CP039712.1 | Vagococcus zengguangii |
| 8 | 1521785 | 1521994 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 9 | 557130 | 557315 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 10 | 3348501 | 3348686 | - | NZ_LS483476.1 | Lederbergia lentus |
| 11 | 553800 | 554009 | - | NZ_CP016843.1 | Carnobacterium divergens |
| 12 | 1045036 | 1045245 | + | NZ_CP049886.1 | Vagococcus coleopterorum |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00122.22 | 0.83 | 10 | 1111.5 | same-strand | E1-E2 ATPase |
| 2 | PF00702.28 | 0.83 | 10 | 1111.5 | same-strand | haloacid dehalogenase-like hydrolase |
| 3 | PF00403.28 | 0.83 | 10 | 17.0 | same-strand | Heavy-metal-associated domain |
| 4 | PF03965.18 | 0.92 | 11 | 15 | same-strand | Penicillinase repressor |