Result : Q47710
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YqjK |
| NCBI Accession ID | U18997.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 30829 |
| Right | 31128 |
| Strand | + |
| Nucleotide Sequence | GTGAGCAGTAAAGTCGAACGTGAACGACGTAAGGCGCAACTGCTTAGCCAGATCCAGCAACAACGGCTGGATCTTTCCGCCAGTCGTCGTGAATGGCTGGAGACAACAGGCGCTTACGATCGTCGCTGGAATATGCTGCTAAGTCTGCGCTCCTGGGCGCTGGTTGGCAGTAGCGTGATGGCGATCTGGACGATTCGCCATCCTAATATGCTGGTCCGCTGGGCCAGACGCGGTTTTGGCGTATGGAGCGCCTGGCGTCTGGTTAAAACGACCCTCAAGCAGCAACAGCTTCGCGGTTAA |
| Sequence | MSSKVERERRKAQLLSQIQQQRLDLSASRREWLETTGAYDRRWNMLLSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGVWSAWRLVKTTLKQQQLRG |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam13997. Profile Description: YqjK-like protein. The YqjK-like protein family includes the E. coli YqjK protein, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are approximately 100 amino acids in length. There is a single completely conserved residue R that may be functionally important. |
| Pubmed ID | 9278503 16738553 |
| Domain | CDD:404817 |
| Functional Category | Others |
| Uniprot ID | Q47710 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 85
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3250077 | 3250376 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3989837 | 3990136 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 3 | 556215 | 556514 | - | NZ_CP061527.1 | Shigella dysenteriae |
| 4 | 3242040 | 3242339 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 5 | 3764521 | 3764820 | + | NZ_LR134340.1 | Escherichia marmotae |
| 6 | 3239729 | 3240028 | + | NZ_AP014857.1 | Escherichia albertii |
| 7 | 3470799 | 3471098 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 8 | 3397508 | 3397807 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 9 | 1259145 | 1259444 | + | NZ_CP053416.1 | Salmonella bongori |
| 10 | 4163697 | 4163996 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 11 | 4032200 | 4032499 | - | NZ_CP038469.1 | Citrobacter tructae |
| 12 | 1832184 | 1832480 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 13 | 4258088 | 4258384 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 14 | 2802609 | 2802905 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 15 | 4100045 | 4100341 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 16 | 4306448 | 4306744 | - | NZ_CP017279.1 | Enterobacter ludwigii |
| 17 | 5038462 | 5038746 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 18 | 1855037 | 1855330 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 19 | 568441 | 568731 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 20 | 581234 | 581533 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 21 | 3015694 | 3015993 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 22 | 2059336 | 2059635 | + | NZ_CP033744.1 | Citrobacter freundii |
| 23 | 4085869 | 4086165 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 24 | 5255521 | 5255814 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 25 | 4205311 | 4205607 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 26 | 2530120 | 2530410 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 27 | 4277821 | 4278111 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 28 | 3205800 | 3206096 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 29 | 3514083 | 3514373 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 30 | 4450424 | 4450720 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 31 | 518070 | 518327 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 32 | 5311716 | 5312006 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 33 | 4015698 | 4015994 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 34 | 2911671 | 2911961 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 35 | 4060155 | 4060451 | + | NC_015968.1 | Enterobacter soli |
| 36 | 512037 | 512327 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 37 | 3646128 | 3646418 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 38 | 1141641 | 1141931 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 39 | 520730 | 520987 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 40 | 4716311 | 4716601 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 41 | 610164 | 610454 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 42 | 633728 | 634000 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 43 | 3707408 | 3707698 | - | NZ_CP045300.1 | Kosakonia arachidis |
| 44 | 3912038 | 3912328 | + | NZ_AP023184.1 | Buttiauxella agrestis |
| 45 | 269590 | 269889 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 46 | 2291120 | 2291374 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 47 | 4344905 | 4345195 | + | NZ_CP023525.1 | Cedecea neteri |
| 48 | 4060774 | 4061052 | + | NZ_LR134201.1 | Cedecea lapagei |
| 49 | 643853 | 644134 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 50 | 627351 | 627647 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 51 | 3993168 | 3993449 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 52 | 1095020 | 1095316 | + | NZ_CP026047.1 | Raoultella planticola |
| 53 | 598012 | 598308 | - | NZ_CP050508.1 | Raoultella terrigena |
| 54 | 587336 | 587632 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 55 | 3700345 | 3700593 | + | NZ_CP061511.1 | Mixta calida |
| 56 | 3065052 | 3065339 | + | NZ_CP028271.1 | Mixta intestinalis |
| 57 | 734889 | 735188 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 58 | 579636 | 579932 | - | NZ_CP041247.1 | Raoultella electrica |
| 59 | 594053 | 594349 | - | NZ_CP054254.1 | Klebsiella variicola |
| 60 | 3922198 | 3922446 | + | NZ_CP026377.1 | Mixta gaviniae |
| 61 | 558683 | 558937 | + | NZ_CP040428.1 | Jejubacter calystegiae |
| 62 | 681865 | 682122 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 63 | 2169238 | 2169525 | - | NZ_CP019706.1 | Pantoea alhagi |
| 64 | 3276227 | 3276523 | + | NZ_LN907827.1 | Erwinia gerundensis |
| 65 | 612358 | 612642 | - | NC_017554.1 | Pantoea ananatis PA13 |
| 66 | 3237634 | 3237879 | + | NC_010694.1 | Erwinia tasmaniensis Et1/99 |
| 67 | 3477718 | 3478002 | + | NZ_CP034148.1 | Pantoea agglomerans |
| 68 | 2284287 | 2284535 | + | NZ_CP049115.1 | Pantoea stewartii |
| 69 | 590188 | 590484 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 70 | 599854 | 600135 | - | NC_014306.1 | Erwinia billingiae Eb661 |
| 71 | 3193386 | 3193667 | + | NC_013961.1 | Erwinia amylovora CFBP1430 |
| 72 | 593581 | 593865 | - | NZ_CP045720.1 | Pantoea eucalypti |
| 73 | 603635 | 603919 | - | NZ_CP038853.1 | Pantoea vagans |
| 74 | 3351381 | 3351662 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
| 75 | 4685987 | 4686283 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 76 | 4281046 | 4281336 | + | NZ_CP065044.1 | Pectobacterium aroidearum |
| 77 | 4579703 | 4579990 | + | NZ_LT906479.1 | Serratia ficaria |
| 78 | 4677518 | 4677805 | + | NZ_CP048784.1 | Serratia liquefaciens |
| 79 | 568898 | 569185 | - | NZ_CP071320.1 | Serratia ureilytica |
| 80 | 4622549 | 4622836 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 81 | 578550 | 578798 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 82 | 4789809 | 4790096 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 83 | 4732485 | 4732733 | + | NZ_LR134494.1 | Serratia quinivorans |
| 84 | 634912 | 635202 | - | NZ_CP034938.1 | Pectobacterium odoriferum |
| 85 | 4468039 | 4468329 | - | NZ_CP017482.1 | Pectobacterium polaris |
| 86 | 2443549 | 2443839 | - | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR134340.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09335.13 | 1.0 | 85 | 1648.5 | same-strand | SNARE associated Golgi protein |
| 2 | PF13721.8 | 0.96 | 82 | 1261 | same-strand | SecD export protein N-terminal TM region |
| 3 | PF06476.14 | 0.99 | 84 | 742 | same-strand | Protein of unknown function (DUF1090) |
| 4 | PF19029.2 | 1.0 | 85 | 398.0 | same-strand | DUF883 C-terminal glycine zipper region |
| 5 | PF05957.15 | 1.0 | 85 | 398.0 | same-strand | DUF883 N-terminal domain |
| 6 | PF07332.13 | 1.0 | 85 | -3.0 | same-strand | Putative Actinobacterial Holin-X, holin superfamily III |
| 7 | PF07681.14 | 0.96 | 82 | 220 | same-strand | DoxX |
| 8 | PF13409.8 | 0.93 | 79 | 708.5 | same-strand | Glutathione S-transferase, N-terminal domain |
| 9 | PF13410.8 | 0.68 | 58 | 707 | same-strand | Glutathione S-transferase, C-terminal domain |
| 10 | PF05656.16 | 0.66 | 56 | 1823.0 | same-strand | Protein of unknown function (DUF805) |
| 11 | PF03466.22 | 0.81 | 69 | 2186.0 | opposite-strand | LysR substrate binding domain |
| 12 | PF00126.29 | 0.81 | 69 | 2186.0 | opposite-strand | Bacterial regulatory helix-turn-helix protein, lysR family |
| 13 | PF02678.18 | 0.74 | 63 | 3180 | same-strand | Pirin |
| 14 | PF17954.3 | 0.75 | 64 | 3179.5 | same-strand | Quercetinase C-terminal cupin domain |
++ More..