Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YlcG |
NCBI Accession ID | X92587.1 |
Organism | Escherichia coli (strain K12) |
Left | 1496 |
Right | 1636 |
Strand | + |
Nucleotide Sequence | ATGATGTTTGAGTTTAATATGGCAGAACTTCTTCGCCACCGCTGGGGGCGTCTGCGCTTATATCGTTTCCCCGGTTCTGTTTTGACCGATTACCGAATACTGAAGAATTACGCCAAAACCCTGACAGGAGCAGGAGTATGA |
Sequence | MMFEFNMAELLRHRWGRLRLYRFPGSVLTDYRILKNYAKTLTGAGV |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of NF033498. Profile Description: YlcG family protein. Members of this family include YlcG from the DLP12 prophage region of Eschichia coli K-12, and homologs from the Gifsy-1 and Gifsy-2 prophage regions of Salmonella enterica subsp. enterica serovar Typhimurium str. LT2. Members of this protein family are small, about 46 amino acids long. YlcG is known to be expressed. It is encoded immediately downstream of the Holliday junction resolvase RusA. |
Pubmed ID | 8648624 9278503 16738553 19121005 |
Domain | CDD:411140 |
Functional Category | Others |
Uniprot ID | Q47272 |
ORF Length (Amino Acid) | 46 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 573730 | 573870 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1853647 | 1853787 | + | NZ_LR134340.1 | Escherichia marmotae |
3 | 1625580 | 1625720 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 899188 | 899310 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
5 | 1767445 | 1767585 | - | NZ_CP057657.1 | Escherichia fergusonii |
6 | 294464 | 294601 | - | NZ_CP033744.1 | Citrobacter freundii |
7 | 4587042 | 4587182 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
8 | 2763577 | 2763717 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
9 | 1328672 | 1328812 | - | NZ_CP023529.1 | Lelliottia amnigena |
10 | 2670496 | 2670636 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
11 | 2448896 | 2449036 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
12 | 1776383 | 1776523 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05866.13 | 0.6 | 6 | -3 | same-strand | Endodeoxyribonuclease RusA |
2 | PF06323.13 | 0.6 | 6 | -3 | same-strand | Phage antitermination protein Q |
3 | PF07105.13 | 0.6 | 6 | 835.5 | same-strand | Protein of unknown function (DUF1367) |