ProsmORF-pred
Result : Q47270
Protein Information
Information Type Description
Protein name Prophage NinE homolog (Protein NinE homolog from lambdoid prophage DLP12)
NCBI Accession ID X92587.1
Organism Escherichia coli (strain K12)
Left 687
Right 857
Strand +
Nucleotide Sequence ATGGCTACACCGCTTATTCGTGTCATGAACGGACACATCTACAGAGTACCAAATCGTCGTAAGCGTAAACCTGAGCTGAAGCCATCCGAAATACCAACACTGCTCGGATATACCGCCAGCTTGGTTGATAAAAAATGGTTGCGACTGGCAGCAAGGAGGAGTCATGGCTGA
Sequence MATPLIRVMNGHIYRVPNRRKRKPELKPSEIPTLLGYTASLVDKKWLRLAARRSHG
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl29974. Profile Description: NINE Protein. prophage protein NinE; Provisional
Pubmed ID 8648624 9278503 16738553
Domain CDD:356850
Functional Category Others
Uniprot ID Q47270
ORF Length (Amino Acid) 56
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 12
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 572921 573091 + NC_000913.3 Escherichia coli str. K-12 substr. MG1655
2 1768224 1768394 - NZ_CP057657.1 Escherichia fergusonii
3 1624771 1624941 + NC_002695.2 Escherichia coli O157:H7 str. Sakai
4 1852838 1853008 + NZ_LR134340.1 Escherichia marmotae
5 2449675 2449845 - NZ_CP054058.1 Scandinavium goeteborgense
6 217824 217994 + NZ_CP016337.1 Kosakonia sacchari
7 2126815 2126985 + NZ_CP045205.1 Citrobacter telavivensis
8 2894036 2894206 - NC_015968.1 Enterobacter soli
9 1302515 1302685 + NC_016845.1 Klebsiella pneumoniae subsp. pneumoniae HS11286
10 2651726 2651893 - NZ_CP012266.1 Cronobacter dublinensis subsp. dublinensis LMG 23823
11 1101274 1101453 + NZ_CP013940.1 Cronobacter malonaticus LMG 23826
12 1678038 1678184 + NZ_CP013940.1 Cronobacter malonaticus LMG 23826
13 2049840 2050022 + NZ_CP012257.1 Cronobacter universalis NCTC 9529
14 2257916 2258086 - NC_017910.1 Shimwellia blattae DSM 4481 = NBRC 105725
++ More..