Protein Information |
Information Type | Description |
---|---|
Protein name | Prophage NinE homolog (Protein NinE homolog from lambdoid prophage DLP12) |
NCBI Accession ID | X92587.1 |
Organism | Escherichia coli (strain K12) |
Left | 687 |
Right | 857 |
Strand | + |
Nucleotide Sequence | ATGGCTACACCGCTTATTCGTGTCATGAACGGACACATCTACAGAGTACCAAATCGTCGTAAGCGTAAACCTGAGCTGAAGCCATCCGAAATACCAACACTGCTCGGATATACCGCCAGCTTGGTTGATAAAAAATGGTTGCGACTGGCAGCAAGGAGGAGTCATGGCTGA |
Sequence | MATPLIRVMNGHIYRVPNRRKRKPELKPSEIPTLLGYTASLVDKKWLRLAARRSHG |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl29974. Profile Description: NINE Protein. prophage protein NinE; Provisional |
Pubmed ID | 8648624 9278503 16738553 |
Domain | CDD:356850 |
Functional Category | Others |
Uniprot ID | Q47270 |
ORF Length (Amino Acid) | 56 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 572921 | 573091 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1768224 | 1768394 | - | NZ_CP057657.1 | Escherichia fergusonii |
3 | 1624771 | 1624941 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 1852838 | 1853008 | + | NZ_LR134340.1 | Escherichia marmotae |
5 | 2449675 | 2449845 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
6 | 217824 | 217994 | + | NZ_CP016337.1 | Kosakonia sacchari |
7 | 2126815 | 2126985 | + | NZ_CP045205.1 | Citrobacter telavivensis |
8 | 2894036 | 2894206 | - | NC_015968.1 | Enterobacter soli |
9 | 1302515 | 1302685 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
10 | 2651726 | 2651893 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
11 | 1101274 | 1101453 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
12 | 1678038 | 1678184 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
13 | 2049840 | 2050022 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
14 | 2257916 | 2258086 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |