Result : Q47268
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YlcH |
| NCBI Accession ID | X92587.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 134 |
| Right | 235 |
| Strand | + |
| Nucleotide Sequence | ATGCGCACATACAATCCAAACTCTCTTCTCCCTTCACAGATGCAGAAATGCACCTGCAATTCTTTGCATCTAGCGTTTGACCTCTGCGGAGGGGAAGCGTGA |
| Sequence | MRTYNPNSLLPSQMQKCTCNSLHLAFDLCGGEA |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 8648624 9278503 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q47268 |
| ORF Length (Amino Acid) | 33 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 572368 | 572469 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 1852285 | 1852386 | + | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 1890630 | 1890731 | + | NZ_LR134340.1 | Escherichia marmotae |
| 4 | 1768846 | 1768947 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 5 | 2126286 | 2126384 | + | NZ_CP045205.1 | Citrobacter telavivensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07102.14 | 0.75 | 3 | 615 | same-strand | Protein of unknown function (DUF1364) |
| 2 | PF05866.13 | 0.75 | 3 | 902 | same-strand | Endodeoxyribonuclease RusA |
++ More..