Protein Information |
Information Type | Description |
---|---|
Protein name | Uncharacterized protein YlcH |
NCBI Accession ID | X92587.1 |
Organism | Escherichia coli (strain K12) |
Left | 134 |
Right | 235 |
Strand | + |
Nucleotide Sequence | ATGCGCACATACAATCCAAACTCTCTTCTCCCTTCACAGATGCAGAAATGCACCTGCAATTCTTTGCATCTAGCGTTTGACCTCTGCGGAGGGGAAGCGTGA |
Sequence | MRTYNPNSLLPSQMQKCTCNSLHLAFDLCGGEA |
Source of smORF | Swiss-Prot |
Function | |
Pubmed ID | 8648624 9278503 |
Domain | |
Functional Category | Others |
Uniprot ID | Q47268 |
ORF Length (Amino Acid) | 33 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 572368 | 572469 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 1852285 | 1852386 | + | NZ_LR134340.1 | Escherichia marmotae |
3 | 1890630 | 1890731 | + | NZ_LR134340.1 | Escherichia marmotae |
4 | 1768846 | 1768947 | - | NZ_CP057657.1 | Escherichia fergusonii |
5 | 2126286 | 2126384 | + | NZ_CP045205.1 | Citrobacter telavivensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07102.14 | 0.75 | 3 | 615 | same-strand | Protein of unknown function (DUF1364) |
2 | PF05866.13 | 0.75 | 3 | 902 | same-strand | Endodeoxyribonuclease RusA |