Protein Information |
Information Type | Description |
---|---|
Protein name | Antitoxin YafN |
NCBI Accession ID | D38582.1 |
Organism | Escherichia coli (strain K12) |
Left | 9647 |
Right | 9940 |
Strand | + |
Nucleotide Sequence | ATGCATCGAATTCTCGCTGAAAAATCGGTCAATATCACTGAGTTACGTAAAAACCCAGCTAAATACTTTATTGATCAACCGGTTGCGGTTCTTTCTAATAATCGCCCCGCAGGATATCTCTTAAGTGCCAGCGCATTCGAAGCGTTAATGGACATGCTTGCTGAACAAGAGGAGAAAAAGCCCATAAAGGCGCGCTTCCGTCCAAGTGCTGCAAGATTAGAGGAAATTACACGCCGCGCTGAACAATATCTTAATGATATGACGGATGATGATTTCAATGACTTTAAGGAATAA |
Sequence | MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRAEQYLNDMTDDDFNDFKE |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Functions as an mRNA interferase antitoxin; overexpression prevents YafO-mediated cessation of cell growth and inhibition of cell proliferation. {ECO:0000269|Pubmed:19617347, ECO:0000269|Pubmed:19943910}. |
Pubmed ID | 7596361 9278503 16738553 12813093 19617347 19943910 |
Domain | CDD:415595 |
Functional Category | Antitoxin_type_2_and_DNA-binding |
Uniprot ID | Q47156 |
ORF Length (Amino Acid) | 97 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 252005 | 252298 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 299410 | 299703 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
3 | 289892 | 290185 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
4 | 3753639 | 3753932 | - | NC_014500.1 | Dickeya dadantii 3937 |
5 | 3965893 | 3966186 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
6 | 3567369 | 3567662 | - | NZ_CP025799.1 | Dickeya zeae |
7 | 1062237 | 1062530 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
8 | 284888 | 285181 | + | NZ_CP014137.1 | Brenneria goodwinii |
9 | 4810441 | 4810734 | - | NZ_CP015137.1 | Dickeya solani IPO 2222 |
10 | 749447 | 749740 | - | NC_012691.1 | Tolumonas auensis DSM 9187 |
11 | 2691244 | 2691537 | - | NC_017554.1 | Pantoea ananatis PA13 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13957.8 | 0.7 | 7 | -3.0 | same-strand | Toxin YafO, type II toxin-antitoxin system |