| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | mRNA interferase toxin YafQ (EC 3.1.-.-) (Endoribonuclease YafQ) (Toxin YafQ) |
| NCBI Accession ID | D38582.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 3603 |
| Right | 3881 |
| Strand | - |
| Nucleotide Sequence | ATGATTCAAAGGGATATTGAATACTCGGGACAATATTCAAAGGATGTAAAACTTGCACAAAAGCGTCATAAGGATATGAATAAATTGAAATATCTTATGACGCTTCTTATCAATAATACTTTACCGCTTCCAGCTGTTTATAAAGACCACCCGCTGCAAGGTTCATGGAAAGGTTATCGCGATGCTCATGTCGAACCGGACTGGATCCTGATTTACAAACTTACCGATAAACTTTTACGATTTGAGAGAACTGGAACTCACGCGGCGCTCTTTGGGTAA |
| Sequence | MIQRDIEYSGQYSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLRFERTGTHAALFG |
| Source of smORF | Swiss-Prot |
| Function | Toxic component of a type II toxin-antitoxin (TA) system (Pubmed:17263853). A sequence-specific mRNA endoribonuclease that inhibits translation elongation and induces bacterial stasis (Pubmed:19210620). Cleavage occurs between the second and third residue of the Lys codon followed by a G or A (5'AAA(G/A)3'), is reading-frame dependent and occurs within the 5' end of most mRNAs (Pubmed:19210620). Ribosome-binding confers the sequence specificity and reading frame-dependence (Pubmed:19210620). When overexpressed in liquid media YafQ partially inhibits protein synthesis, with a reduction in growth rate and colony growth rate. This effect is counteracted by coexpression with cognate antitoxin DinJ (Pubmed:17263853). YafQ and DinJ together bind their own promoter, and repress its expression (Pubmed:24898247). {ECO:0000269|Pubmed:17263853, ECO:0000269|Pubmed:19210620, ECO:0000269|Pubmed:24898247}.; Cell death governed by the MazE-MazF and DinJ-YafQ TA systems seems to play a role in biofilm formation (Pubmed:19707553). mRNA interferases play a role in bacterial persistence to antibiotics (Pubmed:21788497). {ECO:0000269|Pubmed:19707553, ECO:0000269|Pubmed:21788497}. |
| Pubmed ID | 7596361 9278503 16738553 17263853 19307375 19210620 19707553 21788497 24898247 |
| Domain | CDD:419697 |
| Functional Category | DNA-binding_and_RNA-binding_and_Toxin_type_2 |
| Uniprot ID | Q47149 |
| ORF Length (Amino Acid) | 92 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 245961 | 246239 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 3363969 | 3364247 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 3 | 283929 | 284189 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 4 | 3679704 | 3679979 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 5 | 2203203 | 2203436 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 6 | 1455224 | 1455451 | - | NZ_CP053627.1 | Xylella taiwanensis |
| 7 | 283850 | 284125 | - | NZ_CP014527.1 | Haematospirillum jordaniae |
| 8 | 5048 | 5323 | - | NZ_CP014527.1 | Haematospirillum jordaniae |
| 9 | 5546260 | 5546532 | - | NC_008786.1 | Verminephrobacter eiseniae EF01-2 |
| 10 | 3752694 | 3752975 | - | NZ_CP023525.1 | Cedecea neteri |
| 11 | 12384 | 12617 | + | NZ_FO082822.1 | Pseudorhizobium banfieldiae |
| 12 | 303608 | 303835 | - | NZ_CP023276.1 | Polynucleobacter difficilis |
| 13 | 3626837 | 3627097 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 14 | 3513855 | 3514088 | - | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 15 | 703688 | 703960 | - | NZ_CP013232.1 | Collimonas fungivorans |
| 16 | 4767730 | 4767954 | - | NZ_CP050296.1 | Mesorhizobium huakuii |
| 17 | 3596431 | 3596664 | - | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 18 | 216382 | 216615 | + | NZ_CP007029.1 | Thioalkalivibrio paradoxus ARh 1 |
| 19 | 684816 | 685076 | + | NZ_LR134527.1 | Bartonella elizabethae |
| 20 | 1635842 | 1636102 | - | NZ_CP031843.2 | Bartonella kosoyi |
| 21 | 2936305 | 2936538 | - | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 22 | 433195 | 433428 | - | NC_010161.1 | Bartonella tribocorum CIP 105476 |
| 23 | 21936 | 22169 | - | NZ_CP003916.1 | Advenella mimigardefordensis DPN7 |
| 24 | 3894284 | 3894511 | + | NZ_CP063849.1 | Paludibaculum fermentans |
| 25 | 5891877 | 5892107 | + | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 26 | 105984 | 106244 | - | NZ_LR134375.1 | Veillonella dispar |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04221.14 | 0.65 | 15 | 39.0 | same-strand | RelB antitoxin |