Result : A8ERD0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C (Asp/Glu-ADT subunit C) (EC 6.3.5.-) |
| NCBI Accession ID | CP000361.1 |
| Organism | Arcobacter butzleri (strain RM4018) |
| Left | 225983 |
| Right | 226273 |
| Strand | - |
| Nucleotide Sequence | ATGACAGTCGATGATAAATTAATTGCAAAATTAGAAAAATTATCAAGTTTACAAGTTGATGATGAAAGAAAAGAGAAACTAAAATCAGAATTAGCTGATATTATAAACTTTGTTGAAAACTTAAATGATATTGATGTATCAAATATCGAAGCTACTTTTAGCACTATTGAAGGTGGAACTCCACTAAGAGAAGATACTTCAAAACAAGATTTAGAACTATCAAATCATATTTTAAATCATGCTCCCAAAAGTGAAGATGGATACTTTATAGTTCCAAAAATCATTGAGTAA |
| Sequence | MTVDDKLIAKLEKLSSLQVDDERKEKLKSELADIINFVENLNDIDVSNIEATFSTIEGGTPLREDTSKQDLELSNHILNHAPKSEDGYFIVPKIIE |
| Source of smORF | Swiss-Prot |
| Function | Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln). {ECO:0000255|HAMAP-Rule:MF_00122}. |
| Pubmed ID | 18159241 |
| Domain | CDD:412411 |
| Functional Category | Others |
| Uniprot ID | A8ERD0 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 43
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 213341 | 213631 | - | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 2 | 363024 | 363314 | - | NZ_CP032097.1 | Arcobacter ellisii |
| 3 | 350813 | 351103 | - | NZ_CP053833.1 | Arcobacter cloacae |
| 4 | 2302706 | 2302996 | + | NZ_CP035928.1 | Malaciobacter pacificus |
| 5 | 294451 | 294741 | - | NZ_CP030944.1 | Arcobacter aquimarinus |
| 6 | 313697 | 313987 | - | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 7 | 354656 | 354946 | - | NZ_CP053835.1 | Arcobacter defluvii |
| 8 | 390384 | 390674 | - | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 9 | 2761115 | 2761405 | + | NZ_CP053836.1 | Halarcobacter ebronensis |
| 10 | 2663880 | 2664170 | + | NZ_CP041070.1 | Arcobacter anaerophilus |
| 11 | 362576 | 362866 | - | NZ_CP053840.1 | Arcobacter venerupis |
| 12 | 2368718 | 2369008 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 13 | 2525660 | 2525950 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 14 | 2549216 | 2549506 | + | NZ_CP019070.1 | Poseidonibacter parvus |
| 15 | 2472921 | 2473211 | + | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 16 | 2574263 | 2574553 | + | NZ_CP032101.1 | Malaciobacter marinus |
| 17 | 2532041 | 2532331 | + | NZ_CP042812.1 | Malaciobacter canalis |
| 18 | 2469001 | 2469291 | + | NZ_CP031218.1 | Malaciobacter halophilus |
| 19 | 2878897 | 2879187 | + | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 20 | 2007550 | 2007843 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 21 | 2031208 | 2031501 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 22 | 195419 | 195712 | - | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 23 | 545105 | 545395 | - | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 24 | 208224 | 208466 | - | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 25 | 565599 | 565889 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 26 | 1234380 | 1234667 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 27 | 724129 | 724419 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 28 | 752222 | 752512 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 29 | 1719967 | 1720209 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 30 | 219483 | 219782 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 31 | 1143442 | 1143729 | - | NZ_CP059443.1 | Campylobacter fetus |
| 32 | 418505 | 418792 | + | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 33 | 159553 | 159840 | - | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 34 | 616257 | 616547 | - | NZ_AP022826.1 | Nitrosophilus labii |
| 35 | 489150 | 489437 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 36 | 476981 | 477268 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 37 | 466327 | 466614 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 38 | 1248380 | 1248667 | - | NZ_CP010995.1 | Campylobacter iguaniorum |
| 39 | 524945 | 525232 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 40 | 2095023 | 2095313 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 41 | 534709 | 534990 | + | NZ_CP027432.2 | Caminibacter pacificus |
| 42 | 1257708 | 1257995 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 43 | 1371298 | 1371579 | - | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
++ More..