Protein Information |
Information Type | Description |
---|---|
Protein name | F1845 adhesin operon regulatory protein |
NCBI Accession ID | M98766.1 |
Organism | Escherichia coli |
Left | 1118 |
Right | 1375 |
Strand | + |
Nucleotide Sequence | ATGTCCGGTCAGGTGCCGGAATATCAGTTCTGGTTACTGGCTGAGATATCGCCGGTACACAGTGAGAAGGTTATTAATGCGCTGAGGGATTATCTGGTAATGGGATATAACCGTATGGAGGCCTGCGGGCGTCATGGTGTGTCGCCGGGATATTTTTCTGGTGCACTGAAGCGGTTTCAGCGAGTCAGTCAGACGGTATACAGGCTGGTGCCTTTTTATTTCCCGGAGGCGGGTCATGAAGTTCACAGGGGAGAGTGA |
Sequence | MSGQVPEYQFWLLAEISPVHSEKVINALRDYLVMGYNRMEACGRHGVSPGYFSGALKRFQRVSQTVYRLVPFYFPEAGHEVHRGE |
Source of smORF | Swiss-Prot |
Function | Regulates the transcription of genes involved in the biosynthesis of F1845 fimbrial adhesin. |
Pubmed ID | 8097864 |
Domain | CDD:391717 |
Functional Category | Others |
Uniprot ID | Q47133 |
ORF Length (Amino Acid) | 85 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1105264 | 1105485 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
2 | 2809180 | 2809398 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
3 | 2560207 | 2560413 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
4 | 2037725 | 2037931 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
5 | 1215858 | 1216073 | + | NC_015567.1 | Serratia plymuthica AS9 |
6 | 2862943 | 2863149 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00345.22 | 0.67 | 2 | 3110.0 | same-strand | Pili and flagellar-assembly chaperone, PapD N-terminal domain |
2 | PF02753.19 | 0.67 | 2 | 1356 | same-strand | Pili assembly chaperone PapD, C-terminal domain |
3 | PF00577.22 | 0.67 | 2 | 758 | same-strand | Outer membrane usher protein |
4 | PF13953.8 | 0.67 | 2 | 1801.0 | same-strand | PapC C-terminal domain |