Result : Q47133
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | F1845 adhesin operon regulatory protein |
| NCBI Accession ID | M98766.1 |
| Organism | Escherichia coli |
| Left | 1118 |
| Right | 1375 |
| Strand | + |
| Nucleotide Sequence | ATGTCCGGTCAGGTGCCGGAATATCAGTTCTGGTTACTGGCTGAGATATCGCCGGTACACAGTGAGAAGGTTATTAATGCGCTGAGGGATTATCTGGTAATGGGATATAACCGTATGGAGGCCTGCGGGCGTCATGGTGTGTCGCCGGGATATTTTTCTGGTGCACTGAAGCGGTTTCAGCGAGTCAGTCAGACGGTATACAGGCTGGTGCCTTTTTATTTCCCGGAGGCGGGTCATGAAGTTCACAGGGGAGAGTGA |
| Sequence | MSGQVPEYQFWLLAEISPVHSEKVINALRDYLVMGYNRMEACGRHGVSPGYFSGALKRFQRVSQTVYRLVPFYFPEAGHEVHRGE |
| Source of smORF | Swiss-Prot |
| Function | Regulates the transcription of genes involved in the biosynthesis of F1845 fimbrial adhesin. |
| Pubmed ID | 8097864 |
| Domain | CDD:391717 |
| Functional Category | Others |
| Uniprot ID | Q47133 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1105264 | 1105485 | + | NZ_CP016043.1 | Edwardsiella hoshinae |
| 2 | 2809180 | 2809398 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 3 | 2560207 | 2560413 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 4 | 2037725 | 2037931 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 5 | 1215858 | 1216073 | + | NC_015567.1 | Serratia plymuthica AS9 |
| 6 | 2862943 | 2863149 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016043.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00345.22 | 0.67 | 2 | 3110.0 | same-strand | Pili and flagellar-assembly chaperone, PapD N-terminal domain |
| 2 | PF02753.19 | 0.67 | 2 | 1356 | same-strand | Pili assembly chaperone PapD, C-terminal domain |
| 3 | PF00577.22 | 0.67 | 2 | 758 | same-strand | Outer membrane usher protein |
| 4 | PF13953.8 | 0.67 | 2 | 1801.0 | same-strand | PapC C-terminal domain |
++ More..