Result : Q46HA2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Photosystem II reaction center protein K (PSII-K) |
| NCBI Accession ID | CP000095.2 |
| Organism | Prochlorococcus marinus (strain NATL2A) |
| Left | 307096 |
| Right | 307239 |
| Strand | + |
| Nucleotide Sequence | ATGGCACTGATTAATTTCGACTTGCTTGCTGAACTTCCACTTGCATACCAAGCTTTTGCACCAACAGTGGATGTACTTCCGCTAATACCTCTTTTCTTTTTTCTGCTTGTTTTTGTTTGGCAAGCGGCAGTTGGCTTTCGTTAA |
| Sequence | MALINFDLLAELPLAYQAFAPTVDVLPLIPLFFFLLVFVWQAAVGFR |
| Source of smORF | Swiss-Prot |
| Function | One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation. {ECO:0000255|HAMAP-Rule:MF_00441}. |
| Pubmed ID | 18159947 |
| Domain | CDD:421495 |
| Functional Category | Others |
| Uniprot ID | Q46HA2 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1677280 | 1677399 | - | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 2 | 3756194 | 3756313 | - | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 3 | 519063 | 519200 | - | NC_014248.1 | 'Nostoc azollae' 0708 |
| 4 | 4431615 | 4431752 | + | NC_019751.1 | Calothrix sp. PCC 6303 |
| 5 | 554925 | 555062 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 6 | 4869765 | 4869902 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
| 7 | 176083 | 176220 | + | NZ_CP031941.1 | Nostoc sphaeroides |
| 8 | 1613399 | 1613536 | - | NZ_CP054698.1 | Nostoc edaphicum CCNP1411 |
| 9 | 347092 | 347229 | + | NC_010628.1 | Nostoc punctiforme PCC 73102 |
| 10 | 6505492 | 6505629 | - | NZ_CP024785.1 | Nostoc flagelliforme CCNUN1 |
| 11 | 61590 | 61727 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 12 | 7228466 | 7228603 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
| 13 | 2319023 | 2319142 | + | NC_019753.1 | Crinalium epipsammum PCC 9333 |
| 14 | 4216291 | 4216428 | - | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 15 | 2431046 | 2431171 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 16 | 2642743 | 2642865 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 17 | 3905059 | 3905178 | + | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 18 | 590050 | 590187 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 19 | 465544 | 465666 | - | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 20 | 157406 | 157528 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 21 | 194498 | 194617 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 22 | 1034556 | 1034675 | + | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 23 | 295894 | 296037 | + | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 24 | 4041871 | 4041996 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 25 | 1039211 | 1039333 | + | NC_010296.1 | Microcystis aeruginosa NIES-843 |
| 26 | 116604 | 116741 | + | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 27 | 1471377 | 1471514 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
| 28 | 1084291 | 1084416 | + | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 29 | 135855 | 135977 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
++ More..