Result : Q46GT1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) |
| NCBI Accession ID | |
| Organism | Prochlorococcus marinus (strain NATL2A) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MVSLIEKNQLDSFIEKNPSWIIDNKTIKKEFKFENFIEAFGFMSKVALLSEKIDHHPDWQNIYNKVKINLTTHDKGGITTNDIKLAEAIDKLINS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00942. Profile Description: N/A. Pterin 4 alpha carbinolamine dehydratase is also known as DCoH (dimerization cofactor of hepatocyte nuclear factor 1-alpha). |
| Pubmed ID | 18159947 |
| Domain | CDD:412663 |
| Functional Category | Others |
| Uniprot ID | Q46GT1 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 22
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1916081 | 1916368 | + | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 2 | 1518535 | 1518828 | + | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 3 | 721929 | 722216 | + | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 4 | 65372 | 65659 | + | NZ_CP020083.1 | Blastomonas fulva |
| 5 | 4224008 | 4224295 | - | NZ_CP041690.1 | Youhaiella tibetensis |
| 6 | 3762055 | 3762318 | + | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 7 | 3019418 | 3019714 | - | NZ_CP021904.1 | Alkalitalea saponilacus |
| 8 | 262722 | 263012 | + | NZ_CP037948.1 | Qipengyuania sediminis |
| 9 | 2057118 | 2057366 | - | NC_018719.1 | Candidatus Nitrososphaera gargensis Ga9.2 |
| 10 | 4264559 | 4264792 | - | NC_017770.1 | Solitalea canadensis DSM 3403 |
| 11 | 70451 | 70738 | + | NZ_CP060035.1 | Sphingobium fuliginis |
| 12 | 630028 | 630261 | - | NZ_CP022111.1 | Nitrospirillum amazonense CBAmc |
| 13 | 41816 | 42103 | + | NZ_CP021404.1 | Pacificitalea manganoxidans |
| 14 | 1335364 | 1335639 | + | NC_010085.1 | Nitrosopumilus maritimus SCM1 |
| 15 | 1920378 | 1920638 | + | NZ_CP016033.1 | Erythrobacter neustonensis |
| 16 | 2395012 | 2395242 | - | NC_014759.1 | Marivirga tractuosa DSM 4126 |
| 17 | 4023455 | 4023688 | - | NZ_CP020105.1 | Spirosoma rigui |
| 18 | 868291 | 868521 | + | NZ_CP023777.1 | Chitinophaga caeni |
| 19 | 3195426 | 3195692 | - | NZ_CP034909.1 | Ensifer alkalisoli |
| 20 | 4026025 | 4026279 | - | NZ_CP020104.1 | Spirosoma aerolatum |
| 21 | 3193744 | 3194010 | - | NZ_CP023067.1 | Ensifer sojae CCBAU 05684 |
| 22 | 1578819 | 1579058 | - | NZ_CP014263.1 | Spirosoma montaniterrae |
++ More..