Protein Information |
Information Type | Description |
---|---|
Protein name | Ferredoxin-like protein YgcO |
NCBI Accession ID | U00096.3 |
Organism | Escherichia coli (strain K12) |
Left | 2893919 |
Right | 2894179 |
Strand | + |
Nucleotide Sequence | ATGTCTGTAGCCCGTAATCTCTGGCGCGTTGCTGATGCGCCGCACATTGTTCCGGCTGACTCCGTTGAGCGCCAGACGGCAGAACGGTTGATTAACGCCTGTCCGGCAGGTCTTTTTTCGCTCACACCGGAAGGTAACTTACGTATTGACTATCGCAGTTGCCTGGAGTGTGGCACCTGCCGTTTGCTGTGCGACGAATCAACACTACAACAGTGGCGCTATCCGCCTTCCGGATTCGGCATCACCTACCGCTTTGGATAA |
Sequence | MSVARNLWRVADAPHIVPADSVERQTAERLINACPAGLFSLTPEGNLRIDYRSCLECGTCRLLCDESTLQQWRYPPSGFGITYRFG |
Source of smORF | Swiss-Prot |
Function | Could be a 3Fe-4S cluster-containing protein. Probably participates in a redox process with YgcN, YgcQ and YgcR. |
Pubmed ID | 9278503 16738553 |
Domain | CDD:418523 |
Functional Category | Metal-binding |
Uniprot ID | Q46905 |
ORF Length (Amino Acid) | 86 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2893919 | 2894179 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
2 | 864283 | 864543 | - | NZ_CP061527.1 | Shigella dysenteriae |
3 | 3377125 | 3377385 | + | NZ_LR134340.1 | Escherichia marmotae |
4 | 2857941 | 2858201 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
5 | 3614164 | 3614424 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
6 | 3830302 | 3830562 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
7 | 1223051 | 1223311 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
8 | 4390598 | 4390858 | - | NZ_CP038469.1 | Citrobacter tructae |
9 | 1021344 | 1021604 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
10 | 749461 | 749733 | - | NZ_CP023525.1 | Cedecea neteri |
11 | 3189705 | 3189968 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
12 | 2849345 | 2849608 | + | NZ_CP029185.2 | Limnobaculum parvum |
13 | 730058 | 730282 | - | NZ_LR134201.1 | Cedecea lapagei |
14 | 34524 | 34808 | - | NZ_CP014137.1 | Brenneria goodwinii |
15 | 915059 | 915271 | + | NZ_CP025799.1 | Dickeya zeae |
16 | 1604827 | 1605039 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01507.21 | 0.67 | 10 | 5633 | opposite-strand | Phosphoadenosine phosphosulfate reductase family |
2 | PF01077.24 | 0.67 | 10 | 3820 | opposite-strand | Nitrite and sulphite reductase 4Fe-4S domain |
3 | PF03460.19 | 0.67 | 10 | 3820 | opposite-strand | Nitrite/Sulfite reductase ferredoxin-like half domain |
4 | PF00258.27 | 0.67 | 10 | 2021 | opposite-strand | Flavodoxin |
5 | PF00667.22 | 0.67 | 10 | 2021 | opposite-strand | FAD binding domain |
6 | PF00175.23 | 0.67 | 10 | 2021 | opposite-strand | Oxidoreductase NAD-binding domain |
7 | PF01242.21 | 0.67 | 10 | 1343 | same-strand | 6-pyruvoyl tetrahydropterin synthase |
8 | PF04309.14 | 0.73 | 11 | 19.5 | same-strand | Glycerol-3-phosphate responsive antiterminator |
9 | PF00766.21 | 0.93 | 14 | 733.0 | opposite-strand | Electron transfer flavoprotein FAD-binding domain |
10 | PF01012.23 | 0.8 | 12 | 1597.0 | opposite-strand | Electron transfer flavoprotein domain |
11 | PF00083.26 | 0.8 | 12 | 2344.5 | opposite-strand | Sugar (and other) transporter |
12 | PF01565.25 | 0.6 | 9 | 3766 | opposite-strand | FAD binding domain |
13 | PF02913.21 | 0.6 | 9 | 3766 | opposite-strand | FAD linked oxidases, C-terminal domain |