Result : Q46865
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | mRNA interferase toxin MqsR (EC 3.1.-.-) (Endoribonuclease MqsR) (Motility quorum-sensing regulator MqsR) (Toxin MqsR) |
| NCBI Accession ID | U28377.1 |
| Organism | Escherichia coli (strain K12) |
| Left | 122635 |
| Right | 122931 |
| Strand | - |
| Nucleotide Sequence | ATGGAAAAACGCACACCACATACACGTTTGAGTCAGGTTAAAAAACTTGTCAATGCCGGGCAAGTTCGTACAACACGTAGTGCCCTGTTAAATGCAGATGAGTTAGGTTTGGATTTTGATGGTATGTGTAATGTTATCATTGGATTATCAGAGAGCGACTTTTATAAAAGCATGACCACCTACTCTGATCATACTATCTGGCAGGATGTTTACAGACCCAGGCTTGTTACAGGCCAGGTTTATCTTAAAATTACGGTAATTCATGACGTACTGATCGTCTCGTTTAAGGAGAAGTAA |
| Sequence | MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQVYLKITVIHDVLIVSFKEK |
| Source of smORF | Swiss-Prot |
| Function | Toxic component of a type II toxin-antitoxin (TA) system. Plays a significant role in the control of biofilm formation and induction of persister cells in the presence of antibiotics. An mRNA interferase which has been reported to be translation-independent (Pubmed:19690171, Pubmed:19943910, Pubmed:23289863). It has also been reported to be translation-dependent (Pubmed:20041169). Cleavage has been reported to occur on either side of G in the sequence GCU (Pubmed:19690171). Also reported to cleave after C in GC(A/U) sequences (Pubmed:19943910). There are only 14 genes in E.coli W3110 (and probably also MG1655) that do not have a GCU sequence and thus are resistant to the mRNA interferase activity; among these is the gene for toxin GhoT. Overexpression of MqsR causes cessation of cell growth and inhibits cell proliferation via inhibition of translation as well as increasing persister cell formation; these effects are overcome by concomitant or subsequent expression of antitoxin MqsA. Cross-talk can occur between different TA systems. Ectopic expression of this toxin induces transcription of the relBEF TA system operon with specific cleavage of the relBEF mRNA produced (Pubmed:23432955). Regulates the expression of GhoT/GhoS, a type V TA system (Pubmed:23289863). Persistence depends on toxin GhoT activity, which MqsR controls at the post-transcriptional level by selectively degrading the antitoxin ghoS segment of the ghoST mRNA (Pubmed:23289863). Persister cells exhibit antibiotic tolerance without genetic change. mRNA interferases play a role in bacterial persistence to antibiotics; overexpression of this protein induces persisters resistant to coiprofloxacin and ampicillin (Pubmed:21788497). Overexpression leads to a dramatic increase in tolerance to the antibiotic ofloxacin. This TA system mediates cell growth during bile acid deoxycholate stress by degrading mRNA for probable deoxycholate-binding protein YgiS; bile acid detergents such as deoxycholate are important for host defense against bacterial growth in the gall bladder and duodenum (Pubmed:25534751). {ECO:0000269|Pubmed:19690171, ECO:0000269|Pubmed:19943910, ECO:0000269|Pubmed:20041169, ECO:0000269|Pubmed:21788497, ECO:0000269|Pubmed:23289863, ECO:0000269|Pubmed:23432955, ECO:0000269|Pubmed:25534751}.; Initially reported to act as a cotranscription factor with MqsA (Pubmed:19690171, Pubmed:20105222). Following further experiments, the MqsR-MqsA complex does not bind DNA and all reported data are actually due to a small fraction of free MqsA alone binding DNA. Addition of MqsR to a preformed MqsA-promoter DNA complex causes dissociation of the MqsA-DNA complex, probably causing derepression of MqsA-repressed transcripts. Does not bind DNA in the presence or absence of MqsA (Pubmed:23172222). {ECO:0000269|Pubmed:19690171, ECO:0000269|Pubmed:20105222, ECO:0000269|Pubmed:23172222}. |
| Pubmed ID | 9278503 16738553 16768798 16352847 19690171 19909729 20105222 19943910 21516113 21788497 23432955 23289863 23172222 25534751 20041169 |
| Domain | CDD:418509 |
| Functional Category | Toxin_type_2 |
| Uniprot ID | Q46865 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3168248 | 3168544 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 2 | 174085 | 174381 | + | NZ_CP067058.1 | Rahnella aceris |
| 3 | 979714 | 980010 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 4 | 3858315 | 3858611 | + | NZ_CP011104.1 | Photorhabdus thracensis |
| 5 | 4946361 | 4946657 | + | NZ_CP014870.1 | Pseudomonas silesiensis |
| 6 | 19735 | 20031 | + | NZ_CP007231.1 | Yersinia similis |
| 7 | 3774664 | 3774960 | + | NZ_CP019240.1 | Rhodoferax antarcticus |
| 8 | 2579211 | 2579507 | - | NZ_CP016171.1 | Bordetella bronchialis |
| 9 | 3490895 | 3491191 | + | NZ_CP043929.1 | Methylomonas rhizoryzae |
| 10 | 2362936 | 2363232 | - | NZ_AP014568.1 | Serpentinomonas raichei |
| 11 | 1303417 | 1303713 | - | NZ_AP014862.1 | Pseudomonas furukawaii |
| 12 | 2748106 | 2748402 | + | NZ_CP062158.2 | Pseudomonas lundensis |
| 13 | 1266041 | 1266337 | + | NZ_CP031699.1 | Neisseria animalis |
| 14 | 86266 | 86562 | + | NZ_CP011809.2 | Pandoraea faecigallinarum |
| 15 | 1336013 | 1336309 | - | NZ_CP013236.1 | Collimonas pratensis |
| 16 | 2511980 | 2512276 | - | NZ_CP021359.1 | Acidovorax carolinensis |
| 17 | 945738 | 946034 | - | NZ_CP045236.1 | Burkholderia cepacia |
| 18 | 3079963 | 3080259 | - | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 19 | 1732328 | 1732624 | - | NC_007511.1 | Burkholderia lata |
| 20 | 1809878 | 1810177 | + | NZ_CP059569.1 | Kingella oralis |
| 21 | 210446 | 210742 | - | NZ_CP021425.1 | Oleiphilus messinensis |
| 22 | 84709 | 85005 | - | NZ_CP034939.1 | Pectobacterium odoriferum |
| 23 | 2181455 | 2181757 | + | NC_014722.1 | Mycetohabitans rhizoxinica HKI 454 |
| 24 | 43967 | 44269 | - | NZ_AP021882.1 | Sulfuriferula nivalis |
| 25 | 2698024 | 2698320 | - | NZ_CP011504.1 | Burkholderia pyrrocinia |
| 26 | 3667115 | 3667411 | - | NZ_LR134326.1 | Bordetella bronchiseptica |
| 27 | 639802 | 640104 | - | NZ_AP014569.1 | Serpentinomonas mccroryi |
| 28 | 458249 | 458551 | + | NC_004556.1 | Xylella fastidiosa Temecula1 |
| 29 | 20814 | 21116 | + | NC_008760.1 | Polaromonas naphthalenivorans CJ2 |
| 30 | 55436 | 55735 | + | NZ_CP070504.1 | Pseudomonas atacamensis |
| 31 | 517243 | 517497 | + | NZ_CP027792.1 | Pulveribacter suum |
| 32 | 1782415 | 1782711 | - | NZ_CP020738.1 | Paraburkholderia acidophila |
| 33 | 3151348 | 3151650 | + | NZ_CP060711.1 | Thermomonas brevis |
| 34 | 323214 | 323510 | - | NZ_CP011808.2 | Pandoraea faecigallinarum |
| 35 | 318474 | 318776 | + | NZ_CP062803.1 | Cupriavidus basilensis |
| 36 | 4368721 | 4369032 | - | NZ_CP050150.1 | Hafnia alvei |
| 37 | 1395794 | 1396114 | + | NZ_CP009831.1 | Burkholderia multivorans ATCC BAA-247 |
| 38 | 396479 | 396775 | + | NC_017958.1 | Tistrella mobilis KA081020-065 |
| 39 | 5272782 | 5273078 | - | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 40 | 2864697 | 2864999 | - | NZ_CP011930.1 | Herbaspirillum seropedicae |
| 41 | 3788819 | 3789124 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 42 | 1209943 | 1210254 | - | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000913.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF15731.7 | 1.0 | 40 | 3.0 | same-strand | Antitoxin component of bacterial toxin-antitoxin system, MqsA |
++ More..