Result : Q46582
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein DsvD |
| NCBI Accession ID | U16723.1 |
| Organism | Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303) |
| Left | 2771 |
| Right | 3007 |
| Strand | + |
| Nucleotide Sequence | ATGGAAGAAGCCAAGCAGAAAGTCGTTGACTTCCTGAACTCCAAGTCTGGTAGCAAGAGCAAGTTCTACTTCAACGACTTCACCGACCTGTTCCCCGACATGAAGCAGCGTGAAGTGAAGAAGATCCTCACCGCTCTCGTGAACGACGAGGTTCTCGAATACTGGTCCTCGGGCAGCACCACCATGTACGGCCTCAAGGGCGCTGGCAAGCAGGCTGCGGCCGAGCACGAAGACTAG |
| Sequence | MEEAKQKVVDFLNSKSGSKSKFYFNDFTDLFPDMKQREVKKILTALVNDEVLEYWSSGSTTMYGLKGAGKQAAAEHED |
| Source of smORF | Swiss-Prot |
| Function | May play an essential role in dissimilatory sulfite reduction. |
| Pubmed ID | 7887608 15077118 |
| Domain | CDD:370055 |
| Functional Category | Others |
| Uniprot ID | Q46582 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 456992 | 457228 | + | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 2 | 873498 | 873734 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 3 | 3323510 | 3323746 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 4 | 3390653 | 3390889 | + | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 5 | 534656 | 534865 | + | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 6 | 646357 | 646584 | + | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 7 | 1993070 | 1993297 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 8 | 333704 | 333940 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 9 | 482364 | 482612 | - | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 10 | 1477439 | 1477687 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 11 | 3223709 | 3223957 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 12 | 3404410 | 3404631 | + | NZ_CP039543.1 | Desulfovibrio marinus |
| 13 | 1528235 | 1528477 | + | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 14 | 3132571 | 3132819 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 15 | 419839 | 420066 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 16 | 4212671 | 4212898 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 17 | 1604060 | 1604296 | + | NZ_CP014230.1 | Desulfomicrobium orale DSM 12838 |
| 18 | 4749506 | 4749718 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 19 | 4463374 | 4463589 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 20 | 307544 | 307744 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 21 | 1886410 | 1886625 | + | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 22 | 3212438 | 3212653 | + | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 23 | 4695408 | 4695617 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 24 | 4650085 | 4650285 | + | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 25 | 5852071 | 5852310 | - | NZ_CP061800.1 | Desulfonema magnum |
| 26 | 675679 | 675891 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 27 | 1950303 | 1950503 | + | NZ_CP061799.1 | Desulfonema limicola |
| 28 | 1853075 | 1853311 | - | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 29 | 1067167 | 1067367 | - | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 30 | 1606688 | 1606918 | - | NZ_CP017237.1 | Moorella thermoacetica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_017310.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01077.24 | 1.0 | 29 | 670.5 | same-strand | Nitrite and sulphite reductase 4Fe-4S domain |
| 2 | PF03460.19 | 1.0 | 29 | 112.0 | same-strand | Nitrite/Sulfite reductase ferredoxin-like half domain |
| 3 | PF12838.9 | 0.72 | 21 | 69.5 | same-strand | 4Fe-4S dicluster domain |
| 4 | PF07685.16 | 0.9 | 26 | 91 | same-strand | CobB/CobQ-like glutamine amidotransferase domain |
| 5 | PF01656.25 | 0.86 | 25 | 89 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
++ More..