| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Chlorosome envelope protein B (Chlorosome 7.5 kDa protein) (Gerola-Olson chlorosome protein) |
| NCBI Accession ID | |
| Organism | Prosthecochloris vibrioformis (Chlorobium vibrioforme) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MSNGTNIDVAGAINTLTETFGKLFQMQVDVANNSLKALAEVAEPLGKTATDLVASFANVATQVLQNVSSAVAPKK |
| Source of smORF | Swiss-Prot |
| Function | Component of the photosynthetic apparatus which may bind the chlorosome to the bacteriochlorophyll a protein monolayer. |
| Pubmed ID | 8824146 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q46473 |
| ORF Length (Amino Acid) | 75 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2127986 | 2128213 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 2 | 1950473 | 1950700 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 3 | 2232608 | 2232835 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 4 | 2584065 | 2584292 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
| 5 | 2846630 | 2846857 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 6 | 1791570 | 1791794 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 7 | 227469 | 227696 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 8 | 247172 | 247402 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 9 | 2445492 | 2445725 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02583.19 | 0.62 | 5 | 1508 | opposite-strand | Metal-sensitive transcriptional repressor |
| 2 | PF01636.25 | 1.0 | 8 | 85.0 | same-strand | Phosphotransferase enzyme family |
| 3 | PF00483.25 | 1.0 | 8 | 1095.0 | same-strand | Nucleotidyl transferase |
| 4 | PF07075.13 | 1.0 | 8 | 2053.0 | same-strand | Protein of unknown function (DUF1343) |
| 5 | PF00474.19 | 1.0 | 8 | 3259.5 | same-strand | Sodium:solute symporter family |