Result : Q46404
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Late transcription unit B protein |
| NCBI Accession ID | L40838.1 |
| Organism | Chlamydia trachomatis (strain D/UW-3/Cx) |
| Left | 997 |
| Right | 1290 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAAAGAAGCAGTCGCAAGCTAGCTCAAGTGATTGGGCGTAAGACGGGAAACTATTTCCCAGCTTCTATTGAAGGCGAAACCAAGAAAGAGCACAAACATCATTACAGCACAGCCTCAAAAGAAAAAGAGTCTCTACGAAAAAGAGCGAAAGAGTTCGATGTGCTAGTACATTCGTTATTAGATAAACACGTTCCTCAAAATTCTGACCAAGTTTTGATTTTTACGTACCAGAATGGCTTTGTGGAGACAGACTTTCATAATTTTGGGCGATATTCTGTGAAACTGTAG |
| Sequence | MKKRSSRKLAQVIGRKTGNYFPASIEGETKKEHKHHYSTASKEKESLRKRAKEFDVLVHSLLDKHVPQNSDQVLIFTYQNGFVETDFHNFGRYSVKL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17455. Profile Description: Late transcription unit B protein. This is a family of unknown function which is specific to Chlamydia late transcription unit B protein. |
| Pubmed ID | 7543468 9784136 |
| Domain | CDD:407510 |
| Functional Category | Others |
| Uniprot ID | Q46404 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 93614 | 93907 | + | NC_000117.1 | Chlamydia trachomatis D/UW-3/CX |
| 2 | 414708 | 415001 | + | NC_002620.2 | Chlamydia muridarum str. Nigg |
| 3 | 93525 | 93818 | + | NZ_LS398098.1 | Chlamydia suis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000117.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00712.21 | 0.67 | 2 | 3331.5 | opposite-strand | DNA polymerase III beta subunit, N-terminal domain |
| 2 | PF02767.18 | 0.67 | 2 | 3331.5 | opposite-strand | DNA polymerase III beta subunit, central domain |
| 3 | PF02768.17 | 0.67 | 2 | 3331.5 | opposite-strand | DNA polymerase III beta subunit, C-terminal domain |
| 4 | PF01668.20 | 1.0 | 3 | 2594 | same-strand | SmpB protein |
| 5 | PF02424.17 | 1.0 | 3 | 1666 | opposite-strand | ApbE family |
| 6 | PF02882.21 | 1.0 | 3 | 833 | opposite-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 7 | PF00763.25 | 1.0 | 3 | 833 | opposite-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
| 8 | PF13091.8 | 1.0 | 3 | 2538 | opposite-strand | PLD-like domain |
| 9 | PF01977.18 | 1.0 | 3 | 3783 | opposite-strand | 3-octaprenyl-4-hydroxybenzoate carboxy-lyase |
| 10 | PF00830.21 | 1.0 | 3 | 5645 | opposite-strand | Ribosomal L28 family |
++ More..