Protein Information |
Information Type | Description |
---|---|
Protein name | Chlorosome protein E |
NCBI Accession ID | U58654.1 |
Organism | Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
Left | 526 |
Right | 774 |
Strand | + |
Nucleotide Sequence | ATGAACAACCCAAGGGGAGCATTCGTCCAGGGAGCTGAAGCCTATGGCAGGTTTCTTGAGGTATTTATCGATGGCCACTGGTGGGTAGTCGGTGATGCCCTTGAAAATATCGGCAAAACAACCAAAAGACTCGGCGCAAATGCCTACCCTCATCTTTACGGCGGCAGCTCGGGGCTGAAGGGTTCATCTCCGAAGTATTCCGGTTATGCCACACCGAGCAAAGAGGTGAAAAGCAGATTTGAGAAGTGA |
Sequence | MNNPRGAFVQGAEAYGRFLEVFIDGHWWVVGDALENIGKTTKRLGANAYPHLYGGSSGLKGSSPKYSGYATPSKEVKSRFEK |
Source of smORF | Swiss-Prot |
Function | Component of the photosynthetic apparatus. The light harvesting B740 complex binds bacteriochlorophyll c. |
Pubmed ID | 12093901 |
Domain | CDD:396571 |
Functional Category | Metal-binding |
Uniprot ID | Q46386 |
ORF Length (Amino Acid) | 82 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1958459 | 1958707 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
2 | 2453513 | 2453761 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
3 | 482408 | 482665 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
4 | 242215 | 242466 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
5 | 2589072 | 2589329 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
6 | 2241875 | 2242132 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
7 | 1058929 | 1059186 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
8 | 2135882 | 2136139 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
9 | 2611577 | 2611834 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
10 | 232510 | 232761 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07075.13 | 0.75 | 6 | 3001.0 | same-strand | Protein of unknown function (DUF1343) |
2 | PF00474.19 | 0.88 | 7 | 3032 | same-strand | Sodium:solute symporter family |
3 | PF13460.8 | 0.88 | 7 | 636 | opposite-strand | NAD(P)H-binding |
4 | PF00805.24 | 0.75 | 6 | 1321.0 | same-strand | Pentapeptide repeats (8 copies) |
5 | PF13599.8 | 0.75 | 6 | 1321.0 | same-strand | Pentapeptide repeats (9 copies) |
6 | PF13576.8 | 0.62 | 5 | 1566 | same-strand | Pentapeptide repeats (9 copies) |