Result : Q46386
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Chlorosome protein E |
| NCBI Accession ID | U58654.1 |
| Organism | Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) |
| Left | 526 |
| Right | 774 |
| Strand | + |
| Nucleotide Sequence | ATGAACAACCCAAGGGGAGCATTCGTCCAGGGAGCTGAAGCCTATGGCAGGTTTCTTGAGGTATTTATCGATGGCCACTGGTGGGTAGTCGGTGATGCCCTTGAAAATATCGGCAAAACAACCAAAAGACTCGGCGCAAATGCCTACCCTCATCTTTACGGCGGCAGCTCGGGGCTGAAGGGTTCATCTCCGAAGTATTCCGGTTATGCCACACCGAGCAAAGAGGTGAAAAGCAGATTTGAGAAGTGA |
| Sequence | MNNPRGAFVQGAEAYGRFLEVFIDGHWWVVGDALENIGKTTKRLGANAYPHLYGGSSGLKGSSPKYSGYATPSKEVKSRFEK |
| Source of smORF | Swiss-Prot |
| Function | Component of the photosynthetic apparatus. The light harvesting B740 complex binds bacteriochlorophyll c. |
| Pubmed ID | 12093901 |
| Domain | CDD:396571 |
| Functional Category | Metal-binding |
| Uniprot ID | Q46386 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1958459 | 1958707 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 2 | 2453513 | 2453761 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 3 | 482408 | 482665 | - | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 4 | 242215 | 242466 | - | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 5 | 2589072 | 2589329 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
| 6 | 2241875 | 2242132 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 7 | 1058929 | 1059186 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 8 | 2135882 | 2136139 | + | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 9 | 2611577 | 2611834 | + | NC_011060.1 | Pelodictyon phaeoclathratiforme BU-1 |
| 10 | 232510 | 232761 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002932.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF07075.13 | 0.75 | 6 | 3001.0 | same-strand | Protein of unknown function (DUF1343) |
| 2 | PF00474.19 | 0.88 | 7 | 3032 | same-strand | Sodium:solute symporter family |
| 3 | PF13460.8 | 0.88 | 7 | 636 | opposite-strand | NAD(P)H-binding |
| 4 | PF00805.24 | 0.75 | 6 | 1321.0 | same-strand | Pentapeptide repeats (8 copies) |
| 5 | PF13599.8 | 0.75 | 6 | 1321.0 | same-strand | Pentapeptide repeats (9 copies) |
| 6 | PF13576.8 | 0.62 | 5 | 1566 | same-strand | Pentapeptide repeats (9 copies) |
++ More..