Result : Q46213
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0045 protein CPE1503 |
| NCBI Accession ID | U04966.1 |
| Organism | Clostridium perfringens (strain 13 / Type A) |
| Left | 469 |
| Right | 756 |
| Strand | + |
| Nucleotide Sequence | ATGGATACTTGTAATGTTAGTTTACAAATACTTCCCTCAGTAGAGGATTCAAGGCTTTATGAAGTTGTTGATAAGGTTATTGAATATATAGAATCAACAGGAGTAAAGTTTGAGGTTGGTCCTATGGAAACTACCATGGAAGGAAAAATTGATGATTTACTAGAAATTGTGAAAAAATCTCAAGAAATATGCATAGAAGAAGGTGCTGGAAGAGTTATATCAATAGTTAAAATTGATTATAAAAAAGGCGGAGTAACCATGGATGAAAAGGTTGGAAAATATAGATAA |
| Sequence | MDTCNVSLQILPSVEDSRLYEVVDKVIEYIESTGVKFEVGPMETTMEGKIDDLLEIVKKSQEICIEEGAGRVISIVKIDYKKGGVTMDEKVGKYR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00307. Profile Description: Thiamine-binding protein. This protein has been crystallized in both Methanobacterium thermoautotrophicum and yeast, but its function remains unknown. Both crystal structures showed sulfate ions bound at the interface of two dimers to form a tetramer. [Unknown function, General] |
| Pubmed ID | 8052128 11792842 |
| Domain | CDD:412296 |
| Functional Category | Others |
| Uniprot ID | Q46213 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 47
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1972936 | 1973223 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 2 | 2772304 | 2772594 | - | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 3 | 1345362 | 1345652 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 4 | 516323 | 516613 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 5 | 1544310 | 1544579 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 6 | 3273370 | 3273657 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 7 | 1751374 | 1751661 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 8 | 4183691 | 4183981 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 9 | 1392566 | 1392835 | - | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 10 | 4955222 | 4955512 | - | NZ_CP020953.1 | Clostridium drakei |
| 11 | 4954758 | 4955048 | + | NZ_CP009933.1 | Clostridium scatologenes |
| 12 | 2624038 | 2624328 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 13 | 899405 | 899692 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 14 | 4048047 | 4048334 | - | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 15 | 1701993 | 1702280 | - | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 16 | 1252364 | 1252669 | + | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 17 | 868786 | 869037 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 18 | 1420037 | 1420330 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 19 | 929193 | 929486 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 20 | 1248508 | 1248801 | + | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 21 | 1528140 | 1528436 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 22 | 1527651 | 1527887 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 23 | 1212547 | 1212834 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 24 | 1446394 | 1446633 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 25 | 3281898 | 3282188 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 26 | 3069917 | 3070207 | - | NZ_CP028842.1 | Clostridium botulinum |
| 27 | 1541020 | 1541313 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 28 | 3677091 | 3677381 | + | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 29 | 1801700 | 1801936 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 30 | 130275 | 130562 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 31 | 2195945 | 2196232 | - | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 32 | 3770370 | 3770606 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 33 | 3217853 | 3218140 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 34 | 429070 | 429345 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 35 | 2099377 | 2099667 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 36 | 2943053 | 2943379 | - | NC_023035.1 | Salinispira pacifica |
| 37 | 1820293 | 1820589 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 38 | 3552014 | 3552295 | + | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 39 | 3486572 | 3486859 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 40 | 790758 | 791063 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 41 | 253732 | 254010 | + | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 42 | 2837480 | 2837773 | + | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 43 | 776763 | 777056 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 44 | 772132 | 772428 | + | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 45 | 2955393 | 2955716 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 46 | 673023 | 673319 | + | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 47 | 966896 | 967192 | + | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 48 | 1713172 | 1713468 | - | NZ_CP012294.1 | Pediococcus damnosus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_008261.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 0.79 | 37 | 1846.0 | same-strand | ABC transporter |
++ More..