Result : Q45974
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Flagellar biosynthetic protein FliQ |
| NCBI Accession ID | U13663.1 |
| Organism | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) |
| Left | 635 |
| Right | 898 |
| Strand | + |
| Nucleotide Sequence | ATGACGGGCGCCGAGGTTCTTGATGTCGGCCGGGACGCGATCTGGCTGACGCTTCAGCTCTGCGCGCCGGTGCTGATCGTCGGCCTGGTCGTCGGCGTCATCATCGGCCTGTTCCAGGCCCTGACCCAGATCCAGGAAGCCACCCTCGTCTACGCCCCGAAGATCGTGGCGATCTTCATCTCGCTGCTGATCTTCCTACCGCTGATGGGCTCGCTGATGAGCGGCTTCATGCGCCAGATCGCCGCCCGCATCGCCGGCATGTAG |
| Sequence | MTGAEVLDVGRDAIWLTLQLCAPVLIVGLVVGVIIGLFQALTQIQEATLVYAPKIVAIFISLLIFLPLMGSLMSGFMRQIAARIAGM |
| Source of smORF | Swiss-Prot |
| Function | Role in flagellar biosynthesis. |
| Pubmed ID | 7814323 11259647 |
| Domain | CDD:412617 |
| Functional Category | Others |
| Uniprot ID | Q45974 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 68
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1233507 | 1233770 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 2597473 | 2597736 | - | NZ_CP013002.1 | Caulobacter henricii |
| 3 | 812158 | 812421 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 4 | 1021796 | 1022059 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 5 | 2387712 | 2387975 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 6 | 1223393 | 1223656 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 7 | 2773120 | 2773383 | + | NZ_CP026100.1 | Caulobacter flavus |
| 8 | 4214755 | 4215018 | + | NZ_CP026100.1 | Caulobacter flavus |
| 9 | 3471641 | 3471904 | - | NZ_CP027850.1 | Caulobacter segnis |
| 10 | 3095080 | 3095343 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 11 | 2123610 | 2123873 | - | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 12 | 1535727 | 1535990 | - | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 13 | 2055466 | 2055729 | + | NZ_CP022048.2 | Brevundimonas vesicularis |
| 14 | 278976 | 279239 | + | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 15 | 1828393 | 1828659 | - | NZ_CP040517.1 | Luteithermobacter gelatinilyticus |
| 16 | 1777128 | 1777391 | - | NZ_CP029479.1 | Phenylobacterium parvum |
| 17 | 3020499 | 3020765 | - | NZ_CP041025.1 | Paremcibacter congregatus |
| 18 | 2420231 | 2420494 | - | NZ_CP047045.1 | Terricaulis silvestris |
| 19 | 2737811 | 2738074 | - | NC_015684.1 | Afipia carboxidovorans OM5 |
| 20 | 610545 | 610811 | + | NZ_AP018907.1 | Blastochloris tepida |
| 21 | 1579734 | 1580000 | + | NZ_CP053086.1 | Pelagibacterium halotolerans |
| 22 | 4057341 | 4057607 | + | NZ_CP029550.1 | Methylobacterium durans |
| 23 | 2367209 | 2367475 | - | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 24 | 1105937 | 1106203 | + | NZ_CP012946.1 | Blastochloris viridis |
| 25 | 1976219 | 1976485 | - | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 26 | 2688806 | 2689072 | - | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 27 | 1579593 | 1579856 | + | NC_007964.1 | Nitrobacter hamburgensis X14 |
| 28 | 1665591 | 1665854 | - | NZ_CP071057.1 | Marinicauda algicola |
| 29 | 3776221 | 3776487 | + | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 30 | 2880827 | 2881093 | - | NZ_CP041690.1 | Youhaiella tibetensis |
| 31 | 5275777 | 5276043 | + | NZ_CP017147.1 | Bosea vaviloviae |
| 32 | 5645229 | 5645495 | - | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 33 | 5595606 | 5595872 | + | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 34 | 253886 | 254152 | - | NZ_CP039690.1 | Phreatobacter stygius |
| 35 | 4059127 | 4059393 | - | NZ_CP041636.1 | Ferrovibrio terrae |
| 36 | 1245829 | 1246092 | + | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 37 | 3397421 | 3397687 | + | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 38 | 5622503 | 5622766 | - | NZ_CP042968.1 | Bradyrhizobium paxllaeri |
| 39 | 2773567 | 2773830 | + | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 40 | 1156111 | 1156386 | + | NZ_CP030126.1 | Indioceanicola profundi |
| 41 | 5921351 | 5921614 | - | NZ_CP016428.1 | Bradyrhizobium icense |
| 42 | 915003 | 915269 | + | NZ_CP029553.1 | Methylobacterium terrae |
| 43 | 2140608 | 2140874 | - | NZ_CP027668.1 | Phreatobacter cathodiphilus |
| 44 | 3119951 | 3120166 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 45 | 2692570 | 2692836 | - | NZ_CP039546.1 | Methylorubrum populi |
| 46 | 4728395 | 4728658 | + | NZ_CP050066.1 | Bradyrhizobium symbiodeficiens |
| 47 | 2844442 | 2844705 | - | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 48 | 2604456 | 2604719 | + | NZ_CP030053.1 | Bradyrhizobium guangzhouense |
| 49 | 1660170 | 1660436 | + | NC_015259.1 | Polymorphum gilvum SL003B-26A1 |
| 50 | 1700629 | 1700853 | - | NC_016026.1 | Micavibrio aeruginosavorus ARL-13 |
| 51 | 3087905 | 3088168 | + | NZ_CP030051.1 | Bradyrhizobium guangdongense |
| 52 | 4409736 | 4409999 | - | NZ_CP022219.1 | Bradyrhizobium guangxiense |
| 53 | 2567908 | 2568171 | + | NC_017082.1 | Bradyrhizobium cosmicum |
| 54 | 4463684 | 4463947 | - | NZ_CP029426.1 | Bradyrhizobium amphicarpaeae |
| 55 | 6312886 | 6313149 | - | NZ_CP032617.1 | Bradyrhizobium diazoefficiens |
| 56 | 3801274 | 3801537 | + | NZ_CP022221.1 | Bradyrhizobium zhanjiangense |
| 57 | 3007414 | 3007677 | + | NC_020453.1 | Bradyrhizobium oligotrophicum S58 |
| 58 | 6723291 | 6723554 | - | NZ_CP030050.1 | Bradyrhizobium arachidis |
| 59 | 5689822 | 5690085 | + | NZ_CP044543.1 | Bradyrhizobium betae |
| 60 | 1577635 | 1577901 | + | NZ_CP021330.1 | Maritalea myrionectae |
| 61 | 454281 | 454496 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 62 | 6064717 | 6064980 | - | NZ_CP058354.1 | Bradyrhizobium japonicum |
| 63 | 5313558 | 5313821 | + | NZ_CP029425.1 | Bradyrhizobium ottawaense |
| 64 | 2627639 | 2627851 | - | NZ_CP061205.1 | Kordiimonas pumila |
| 65 | 3090325 | 3090588 | + | NZ_LS398110.1 | Bradyrhizobium vignae |
| 66 | 1703375 | 1703641 | - | NZ_CP042304.1 | Devosia ginsengisoli |
| 67 | 4297630 | 4297893 | - | NZ_CP058907.1 | Rhodopseudomonas palustris |
| 68 | 1224456 | 1224725 | - | NZ_CP046908.1 | Stappia indica |
| 69 | 3257926 | 3258144 | - | NC_017584.1 | Rhodospirillum rubrum F11 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015684.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01311.22 | 0.99 | 67 | 18 | same-strand | Bacterial export proteins, family 1 |
| 2 | PF01312.21 | 1.0 | 68 | 796.0 | same-strand | FlhB HrpN YscU SpaS Family |
| 3 | PF02518.28 | 0.97 | 66 | 2034.0 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 4 | PF00072.26 | 0.97 | 66 | 2034.5 | same-strand | Response regulator receiver domain |
| 5 | PF00512.27 | 0.96 | 65 | 2034.5 | same-strand | His Kinase A (phospho-acceptor) domain |
| 6 | PF00460.22 | 0.69 | 47 | 459.0 | same-strand | Flagella basal body rod protein |
| 7 | PF02049.20 | 0.79 | 54 | 109.5 | same-strand | Flagellar hook-basal body complex protein FliE |
| 8 | PF00813.22 | 0.6 | 41 | 2655 | opposite-strand | FliP family |
| 9 | PF08448.12 | 0.72 | 49 | 2036 | same-strand | PAS fold |
++ More..