Result : Q45973
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein CC_1074 |
| NCBI Accession ID | U13663.1 |
| Organism | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) |
| Left | 182 |
| Right | 484 |
| Strand | + |
| Nucleotide Sequence | GTGATCGCTTCGCTCGCTCTCGCCGCCGCCGTCTTCGCCGCCGCCCCTCAGGCCCAGGCCCAGACGGACCTGCTGAAGCCCGTGTCCGAGCCGCGCATCGCGGTCGCGATCCTGAACTGCCTGGTGAAGAACGACGGCTATCTGACCGCCTGCACCGTGCAGGACGAGAGCCCCAATGACCTGGGCGTCGGCCAGGCCGCGCTGTCGATGGTCTCCCAGGTCCAGGTCGATCTGCTGGGCCCCGACGGCAAGAGCCGTGCGGGCTCGTACATCCAGGTGCCGGTGCGTATCCGCATCCGCTAA |
| Sequence | MIASLALAAAVFAAAPQAQAQTDLLKPVSEPRIAVAILNCLVKNDGYLTACTVQDESPNDLGVGQAALSMVSQVQVDLLGPDGKSRAGSYIQVPVRIRIR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 7814323 11259647 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q45973 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1233054 | 1233356 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 2597933 | 2598232 | - | NZ_CP013002.1 | Caulobacter henricii |
| 3 | 3472742 | 3473014 | - | NZ_CP027850.1 | Caulobacter segnis |
| 4 | 101597 | 101902 | - | NZ_CP026100.1 | Caulobacter flavus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01313.21 | 0.75 | 3 | 197 | same-strand | Bacterial export proteins, family 3 |
| 2 | PF01311.22 | 0.75 | 3 | 477 | same-strand | Bacterial export proteins, family 1 |
| 3 | PF01312.21 | 0.75 | 3 | 1242 | same-strand | FlhB HrpN YscU SpaS Family |
| 4 | PF02518.28 | 0.75 | 3 | 2446 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 5 | PF00072.26 | 0.75 | 3 | 2446 | same-strand | Response regulator receiver domain |
| 6 | PF00512.27 | 0.75 | 3 | 2446 | same-strand | His Kinase A (phospho-acceptor) domain |
++ More..