Result : Q45605
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YycQ |
| NCBI Accession ID | D78193.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 18909 |
| Right | 19157 |
| Strand | - |
| Nucleotide Sequence | ATGGGAGCCATCGCCGTTTTATTTATCGTTTTTGGTTTTCCGATCGTCGCAGGTGTATTTGGTATAGCGGGTCATTTTTTATTTAAAAGATTTTGGGTGGCACCGCTCATCGTTCTTATCACGAGCTTGATATTGTTAGTTACGTTAGCTTCGGGGAATAGCTCATTCATATTTTGGGTTGTTATGTATACGGCAATTGCGTTAGTAACGAGTGTTGCCACATTATTTCTCAGGAAATTTTTTGAGTGA |
| Sequence | MGAIAVLFIVFGFPIVAGVFGIAGHFLFKRFWVAPLIVLITSLILLVTLASGNSSFIFWVVMYTAIALVTSVATLFLRKFFE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10852. Profile Description: Protein of unknown function (DUF2651). This family of proteins with unknown function appears to be restricted to Bacillus spp. |
| Pubmed ID | 9205843 9384377 |
| Domain | CDD:371270 |
| Functional Category | Others |
| Uniprot ID | Q45605 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4137362 | 4137610 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 63570 | 63818 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 2105429 | 2105677 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 4 | 3949681 | 3949929 | - | NZ_CP051464.1 | Bacillus mojavensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02590.19 | 1.0 | 4 | 2490.5 | same-strand | Predicted SPOUT methyltransferase |
| 2 | PF14116.8 | 1.0 | 4 | 2239.5 | same-strand | YyzF-like protein |
| 3 | PF08240.14 | 1.0 | 4 | 397.0 | same-strand | Alcohol dehydrogenase GroES-like domain |
| 4 | PF13302.9 | 0.75 | 3 | 2079 | same-strand | Acetyltransferase (GNAT) domain |
| 5 | PF18801.3 | 1.0 | 4 | 2659.0 | opposite-strand | response regulator aspartate phosphatase H, N terminal |
| 6 | PF13424.8 | 1.0 | 4 | 2659.0 | opposite-strand | Tetratricopeptide repeat |
++ More..