Protein Information |
Information Type | Description |
---|---|
Protein name | Putative exported peptide YydF |
NCBI Accession ID | D78193.1 |
Organism | Bacillus subtilis (strain 168) |
Left | 9044 |
Right | 9193 |
Strand | - |
Nucleotide Sequence | ATGAAAAAGGAAATCACTAACAATGAGACTGTGAAAAACTTAGAATTTAAGGGTCTATTAGATGAATCACAAAAGTTAGCAAAAGTGAATGATCTTTGGTATTTTGTAAAATCAAAAGAAAATCGCTGGATTCTTGGAAGTGGTCATTAA |
Sequence | MKKEITNNETVKNLEFKGLLDESQKLAKVNDLWYFVKSKENRWILGSGH |
Source of smORF | Swiss-Prot |
Function | Suggested to be the precursor for an exported, modified peptide that has antimicrobial and/or signaling properties. Synthesis requires YydG and YydH; the peptide is proposed to be exported by the YydIJ transporter. In the absence of the transporter, the modified peptide activates the LiaRS two-component regulatory system, possibly by eliciting cell envelope stress. This activation can occur in trans in cocultured cells lacking either the transporter or the whole operon. |
Pubmed ID | 9205843 9384377 15101989 17921301 |
Domain | CDD:188592 |
Functional Category | Others |
Uniprot ID | Q45596 |
ORF Length (Amino Acid) | 49 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4127498 | 4127647 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
2 | 51320 | 51469 | - | NZ_CP033052.1 | Bacillus vallismortis |
3 | 1862051 | 1862200 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
4 | 2573 | 2728 | + | NZ_CP065730.1 | Macrococcus caseolyticus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00005.29 | 1.0 | 4 | 1906.5 | same-strand | ABC transporter |
2 | PF13394.8 | 1.0 | 4 | 63.0 | same-strand | 4Fe-4S single cluster domain |