Result : Q45596
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative exported peptide YydF |
| NCBI Accession ID | D78193.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 9044 |
| Right | 9193 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAAGGAAATCACTAACAATGAGACTGTGAAAAACTTAGAATTTAAGGGTCTATTAGATGAATCACAAAAGTTAGCAAAAGTGAATGATCTTTGGTATTTTGTAAAATCAAAAGAAAATCGCTGGATTCTTGGAAGTGGTCATTAA |
| Sequence | MKKEITNNETVKNLEFKGLLDESQKLAKVNDLWYFVKSKENRWILGSGH |
| Source of smORF | Swiss-Prot |
| Function | Suggested to be the precursor for an exported, modified peptide that has antimicrobial and/or signaling properties. Synthesis requires YydG and YydH; the peptide is proposed to be exported by the YydIJ transporter. In the absence of the transporter, the modified peptide activates the LiaRS two-component regulatory system, possibly by eliciting cell envelope stress. This activation can occur in trans in cocultured cells lacking either the transporter or the whole operon. |
| Pubmed ID | 9205843 9384377 15101989 17921301 |
| Domain | CDD:188592 |
| Functional Category | Others |
| Uniprot ID | Q45596 |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4127498 | 4127647 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 51320 | 51469 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 1862051 | 1862200 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 4 | 2573 | 2728 | + | NZ_CP065730.1 | Macrococcus caseolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00005.29 | 1.0 | 4 | 1906.5 | same-strand | ABC transporter |
| 2 | PF13394.8 | 1.0 | 4 | 63.0 | same-strand | 4Fe-4S single cluster domain |
++ More..