Result : Q45560
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Ferredoxin 7Fe (Seven-iron ferredoxin) |
| NCBI Accession ID | D29804.1 |
| Organism | Hydrogenibacillus schlegelii (Bacillus schlegelii) |
| Left | 8 |
| Right | 244 |
| Strand | + |
| Nucleotide Sequence | ATGGCCTACGTCATTACCGAGCCGTGTATCGGGACCAAAGATGCGAGTTGCGTCGAGGTCTGCCCGGTGGACTGCATCCACGAAGGGGAAGACCAGTACTACATCGACCCCGACGTGTGCATCGACTGTGGCGCGTGCGAAGCGGTCTGCCCGGTGTCCGCGATCTACCACGAAGATTTCGTGCCGGAAGAGTGGAAGTCCTACATCCAGAAAAACCGAGACTTCTTTAAGAAGTGA |
| Sequence | MAYVITEPCIGTKDASCVEVCPVDCIHEGEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam00037. Profile Description: 4Fe-4S binding domain. Superfamily includes proteins containing domains which bind to iron-sulfur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich.**The ORF matches to the profile of pfam12838. Profile Description: 4Fe-4S dicluster domain. Superfamily includes proteins containing domains which bind to iron-sulfur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Domain contains two 4Fe4S clusters.**The ORF matches to the profile of COG1146. Profile Description: NAD-dependent dihydropyrimidine dehydrogenase, PreA subunit [Nucleotide transport and metabolism]. |
| Pubmed ID | 8003034 1338329 9657695 9276454 |
| Domain | CDD:394993,CDD:403902,CDD:224069 |
| Functional Category | Metal-binding |
| Uniprot ID | Q45560 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 100
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1574209 | 1574445 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 2 | 1695211 | 1695447 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 3 | 2405784 | 2406017 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 4 | 2293783 | 2294019 | + | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 5 | 3504633 | 3504866 | - | NZ_AP014924.1 | Limnochorda pilosa |
| 6 | 310955 | 311191 | + | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 7 | 1815531 | 1815758 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 8 | 2028132 | 2028380 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 9 | 1631648 | 1631881 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 10 | 1688696 | 1688929 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 11 | 1648813 | 1649046 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 12 | 888551 | 888790 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 13 | 3660768 | 3661007 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 14 | 2574279 | 2574548 | - | NZ_CP042430.1 | Baekduia soli |
| 15 | 612432 | 612695 | + | NZ_CP042430.1 | Baekduia soli |
| 16 | 1950803 | 1951042 | - | NC_013205.1 | Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446 |
| 17 | 1417300 | 1417551 | - | NC_011959.1 | Thermomicrobium roseum DSM 5159 |
| 18 | 658700 | 658945 | - | NC_013525.1 | Thermobaculum terrenum ATCC BAA-798 |
| 19 | 699574 | 699816 | + | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 20 | 1989392 | 1989634 | + | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 21 | 2198664 | 2198903 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 22 | 1944169 | 1944408 | - | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 23 | 2319670 | 2319906 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 24 | 3110171 | 3110404 | + | NZ_CP035485.1 | Salicibibacter halophilus |
| 25 | 2366853 | 2367092 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 26 | 1351667 | 1351906 | + | NZ_CP022437.1 | Virgibacillus necropolis |
| 27 | 1292632 | 1292868 | + | NZ_CP011361.2 | Salimicrobium jeotgali |
| 28 | 249663 | 249902 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 29 | 1624775 | 1625014 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 30 | 298319 | 298570 | + | NC_013526.1 | Thermobaculum terrenum ATCC BAA-798 |
| 31 | 1330874 | 1331113 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 32 | 2523548 | 2523787 | - | NZ_CP007514.1 | Rubrobacter radiotolerans |
| 33 | 3399061 | 3399303 | + | NZ_LS483476.1 | Lederbergia lentus |
| 34 | 2417114 | 2417377 | + | NZ_CP007128.1 | Gemmatirosa kalamazoonesis |
| 35 | 1780743 | 1780979 | + | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 36 | 2125942 | 2126178 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 37 | 1222068 | 1222301 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 38 | 2998789 | 2999022 | + | NZ_CP031092.1 | Salicibibacter kimchii |
| 39 | 1534412 | 1534651 | - | NZ_CP008876.1 | Terribacillus goriensis |
| 40 | 9393351 | 9393608 | + | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 41 | 3322301 | 3322561 | + | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 42 | 3560928 | 3561191 | - | NC_012489.1 | Gemmatimonas aurantiaca T-27 |
| 43 | 361294 | 361533 | + | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
| 44 | 169950 | 170189 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 45 | 2888329 | 2888571 | + | NZ_AP021853.1 | Sporolactobacillus terrae |
| 46 | 2005065 | 2005304 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 47 | 3121585 | 3121824 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
| 48 | 202996 | 203235 | + | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 49 | 275534 | 275794 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 50 | 275279 | 275530 | - | NC_014212.1 | Meiothermus silvanus DSM 9946 |
| 51 | 2547302 | 2547538 | - | NZ_CP031115.1 | Rubrobacter indicoceani |
| 52 | 3119288 | 3119524 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 53 | 1230014 | 1230253 | + | NZ_CP016312.1 | Thermus brockianus |
| 54 | 408429 | 408698 | - | NZ_CP016312.1 | Thermus brockianus |
| 55 | 1953625 | 1953864 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 56 | 1002479 | 1002739 | - | NC_019386.1 | Thermus oshimai JL-2 |
| 57 | 191381 | 191620 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 58 | 1031733 | 1031981 | - | NZ_CP007139.1 | Fimbriimonas ginsengisoli Gsoil 348 |
| 59 | 2267780 | 2268028 | + | NZ_CP007139.1 | Fimbriimonas ginsengisoli Gsoil 348 |
| 60 | 3175423 | 3175656 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 61 | 2118793 | 2119032 | + | NZ_CP038452.1 | Thermus caldilimi |
| 62 | 1046318 | 1046584 | - | NZ_CP038452.1 | Thermus caldilimi |
| 63 | 2804605 | 2804844 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 64 | 1215488 | 1215727 | + | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 65 | 1217683 | 1217946 | - | NC_008148.1 | Rubrobacter xylanophilus DSM 9941 |
| 66 | 3649097 | 3649360 | - | NZ_CP011454.1 | Gemmatimonas phototrophica |
| 67 | 1309739 | 1309999 | + | NZ_AP018920.1 | Pseudonocardia autotrophica |
| 68 | 1030589 | 1030825 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 69 | 3107595 | 3107831 | - | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 70 | 2035812 | 2036048 | - | NC_015161.1 | Deinococcus proteolyticus MRP |
| 71 | 2003339 | 2003581 | + | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
| 72 | 1515266 | 1515538 | - | NZ_CP043930.1 | Gimesia benthica |
| 73 | 6295545 | 6295808 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 74 | 5550170 | 5550430 | - | NZ_CP015136.1 | Luteitalea pratensis |
| 75 | 1214737 | 1214982 | - | NZ_CP053989.1 | Niallia circulans |
| 76 | 2049339 | 2049578 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 77 | 2882139 | 2882378 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 78 | 727676 | 727909 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 79 | 438523 | 438756 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 80 | 655520 | 655759 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 81 | 380675 | 380914 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 82 | 672036 | 672275 | + | NZ_CP038012.1 | Sporosarcina pasteurii |
| 83 | 3681663 | 3681902 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 84 | 396962 | 397231 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 85 | 235445 | 235684 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 86 | 3441300 | 3441536 | - | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 87 | 3005342 | 3005578 | + | NC_014958.1 | Deinococcus maricopensis DSM 21211 |
| 88 | 1110022 | 1110282 | + | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 89 | 1119112 | 1119351 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
| 90 | 3130520 | 3130759 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 91 | 2264650 | 2264889 | + | NZ_CP022315.1 | Virgibacillus phasianinus |
| 92 | 3060098 | 3060358 | - | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 93 | 1229181 | 1229441 | + | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 94 | 2524800 | 2525069 | + | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 95 | 6226388 | 6226651 | + | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 96 | 3732479 | 3732736 | + | NZ_CP036425.1 | Poriferisphaera corsica |
| 97 | 1929130 | 1929369 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 98 | 2696517 | 2696756 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 99 | 2210383 | 2210643 | + | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 100 | 1799689 | 1799928 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 101 | 3326208 | 3326444 | - | NZ_CP041666.1 | Radiobacillus deserti |
| 102 | 4740046 | 4740324 | + | NZ_CP036291.1 | Pirellulimonas nuda |
| 103 | 3883021 | 3883281 | - | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 104 | 2340376 | 2340612 | - | NZ_CP010028.1 | Deinococcus radiopugnans |
| 105 | 1366451 | 1366687 | - | NZ_CP010028.1 | Deinococcus radiopugnans |
| 106 | 4438541 | 4438801 | - | NZ_CP063458.1 | Humisphaera borealis |
| 107 | 6949172 | 6949435 | + | NZ_CP063458.1 | Humisphaera borealis |
| 108 | 5545385 | 5545645 | + | NZ_CP063849.1 | Paludibaculum fermentans |
| 109 | 837206 | 837442 | + | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 110 | 2332553 | 2332789 | - | NC_008025.1 | Deinococcus geothermalis DSM 11300 |
| 111 | 1411201 | 1411461 | + | NC_014963.1 | Terriglobus saanensis SP1PR4 |
| 112 | 1774003 | 1774242 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 113 | 2638743 | 2638982 | - | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 114 | 345440 | 345676 | + | NZ_CP013910.1 | Deinococcus actinosclerus |
| 115 | 1525104 | 1525340 | + | NZ_CP031500.1 | Deinococcus radiodurans |
| 116 | 755270 | 755509 | - | NZ_CP045296.1 | Paenibacillus cellulositrophicus |
| 117 | 1452210 | 1452446 | - | NZ_CP011389.1 | Deinococcus soli (ex Cha et al. 2016) |
| 118 | 2233132 | 2233371 | + | NZ_CP020772.1 | Halobacillus mangrovi |
| 119 | 2777471 | 2777707 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 120 | 3025413 | 3025649 | + | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 121 | 2327723 | 2327959 | + | NC_019793.1 | Deinococcus peraridilitoris DSM 19664 |
| 122 | 467568 | 467816 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
| 123 | 272512 | 272748 | + | NZ_CP029494.1 | Deinococcus irradiatisoli |
| 124 | 379649 | 379885 | + | NZ_CP021081.1 | Deinococcus ficus |
| 125 | 3451226 | 3451462 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 126 | 4915648 | 4915908 | - | NZ_CP042806.1 | Terriglobus albidus |
| 127 | 2667458 | 2667694 | - | NC_012526.1 | Deinococcus deserti VCD115 |
| 128 | 499872 | 500108 | - | NZ_CP011387.1 | Deinococcus puniceus |
| 129 | 856049 | 856297 | + | NZ_CP011387.1 | Deinococcus puniceus |
| 130 | 5805521 | 5805757 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 131 | 2974507 | 2974743 | + | NC_017790.1 | Deinococcus gobiensis I-0 |
| 132 | 1205600 | 1205872 | + | NZ_CP036353.1 | Gimesia maris |
| 133 | 3376119 | 3376394 | - | NC_005027.1 | Rhodopirellula baltica SH 1 |
| 134 | 6081689 | 6081943 | + | NC_005027.1 | Rhodopirellula baltica SH 1 |
| 135 | 1874351 | 1874608 | + | NZ_CP042914.1 | Roseimaritima ulvae |
| 136 | 8976 | 9230 | - | NC_014148.1 | Planctopirus limnophila DSM 3776 |
| 137 | 3594876 | 3595151 | - | NZ_LR593887.1 | Tuwongella immobilis |
| 138 | 1409774 | 1410052 | - | NZ_CP036292.1 | Rosistilla oblonga |
| 139 | 2214083 | 2214322 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 140 | 256248 | 256505 | + | NC_019897.1 | Thermobacillus composti KWC4 |
| 141 | 6436529 | 6436801 | + | NZ_CP017641.1 | Fuerstia marisgermanicae |
| 142 | 2259682 | 2259915 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 143 | 4448819 | 4449091 | + | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
++ More..