Result : Q45536
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Protein CotJA |
| NCBI Accession ID | L38014.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 326 |
| Right | 574 |
| Strand | + |
| Nucleotide Sequence | ATGAAGGATATGCAGCCGTTTACGCCTGTCAAATCATATACGCCCTTTCACAGCCGTTTTGATCCCTGTCCGCCCATAGGGAAGAAATATTACAGAACGCCCCCTAACCTTTATATGACCTTTCAGCCTGAGCACATGGAGCAGTTTTCGCCGATGGAGGCTTTGAGGAAAGGCACCCTTTGGAAGGATCTCTATGATTTTTATGAAAACCCTTATCGAGGGGGAGACGCACATGGCAAAAAAGGTTGA |
| Sequence | MKDMQPFTPVKSYTPFHSRFDPCPPIGKKYYRTPPNLYMTFQPEHMEQFSPMEALRKGTLWKDLYDFYENPYRGGDAHGKKG |
| Source of smORF | Swiss-Prot |
| Function | The cotJ operon proteins affect spore coat composition. They are either required for the normal formation of the inner layers of the coat or are themselves structural components of the coat. |
| Pubmed ID | 7768848 9384377 |
| Domain | CDD:402549 |
| Functional Category | Others |
| Uniprot ID | Q45536 |
| ORF Length (Amino Acid) | 82 |
++ More..
| Conservation Analysis |
No. of Species: 53
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 755907 | 756155 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 737227 | 737475 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 752286 | 752534 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 4 | 738820 | 739068 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 5 | 1253010 | 1253258 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 950169 | 950417 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 724513 | 724761 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 8 | 3234726 | 3234974 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 708629 | 708877 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 5084030 | 5084263 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 11 | 1151853 | 1152086 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 12 | 1238475 | 1238708 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 13 | 1207468 | 1207710 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 225325 | 225558 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 15 | 2719342 | 2719581 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 16 | 3146268 | 3146495 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 17 | 585540 | 585755 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 18 | 821562 | 821765 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 19 | 740989 | 741192 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 20 | 811584 | 811787 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 21 | 830563 | 830766 | - | NC_011725.1 | Bacillus cereus B4264 |
| 22 | 4308099 | 4308302 | + | NZ_CP040336.1 | Bacillus luti |
| 23 | 825192 | 825395 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 24 | 3604526 | 3604753 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 25 | 2088993 | 2089250 | + | NZ_CP012024.1 | Bacillus smithii |
| 26 | 4629089 | 4629319 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 27 | 1737839 | 1738075 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 28 | 4760116 | 4760355 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 29 | 3176555 | 3176785 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 30 | 922878 | 923132 | + | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 31 | 2353447 | 2353674 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 32 | 2568890 | 2569129 | + | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 33 | 1856920 | 1857126 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 34 | 3458433 | 3458672 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 35 | 732664 | 732867 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 36 | 1934974 | 1935174 | + | NC_014098.1 | Kyrpidia tusciae DSM 2912 |
| 37 | 2276123 | 2276353 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 38 | 3688201 | 3688431 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 39 | 10472 | 10702 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 40 | 980073 | 980303 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 41 | 1488319 | 1488549 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 42 | 1675496 | 1675726 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 43 | 2071765 | 2071983 | + | NZ_CP009428.1 | Paenibacillus odorifer |
| 44 | 2745636 | 2745863 | - | NZ_CP021434.1 | Tumebacillus avium |
| 45 | 1644122 | 1644352 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 46 | 2325546 | 2325785 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 47 | 1345613 | 1345828 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 48 | 3222719 | 3222949 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 49 | 2131162 | 2131392 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 50 | 3861130 | 3861354 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 51 | 3786844 | 3787071 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 52 | 1612763 | 1612987 | + | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 53 | 3050682 | 3050909 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 54 | 1600910 | 1601137 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12652.9 | 1.0 | 53 | -3.0 | same-strand | CotJB protein |
++ More..