Result : Q45069
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YnfE |
| NCBI Accession ID | Z73234.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 23868 |
| Right | 24131 |
| Strand | + |
| Nucleotide Sequence | GTGGATGAAATACTGAAACAGTATATGGTGCTGTATAAAAAAATGAGTAATATGATAAATGGTCCCGACTATCCAGGTAAGGAAAAAGACATCCAGCATCAAAAAGATCAGATCGAAGTTTACGAAAAACAGCTGCAGCAAGGATTTTCTACAGATTATGACTATGATGTGTTTGCTGATTCTGTTATCAAATGCGCATATGGCGATATGACGCTGGAAGATTTAGAAGCCGTTTATTATGGATTGACAACACCATTTTTTTGA |
| Sequence | MDEILKQYMVLYKKMSNMINGPDYPGKEKDIQHQKDQIEVYEKQLQQGFSTDYDYDVFADSVIKCAYGDMTLEDLEAVYYGLTTPFF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam17452. Profile Description: Uncharacterized protein YnfE. This is a family of unknown function found in Bacillus. |
| Pubmed ID | 8969507 9384377 17218307 |
| Domain | CDD:340167 |
| Functional Category | Others |
| Uniprot ID | Q45069 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 10
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1942192 | 1942455 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1906008 | 1906271 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1850516 | 1850779 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1904165 | 1904428 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 5 | 27960 | 28220 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 6 | 2055164 | 2055427 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 7 | 1869400 | 1869660 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 2285857 | 2286117 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 9 | 2030891 | 2031148 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 10 | 2081163 | 2081420 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00521.22 | 0.7 | 7 | 4324 | same-strand | DNA gyrase/topoisomerase IV, subunit A |
| 2 | PF03989.15 | 0.7 | 7 | 4324 | same-strand | DNA gyrase C-terminal domain, beta-propeller |
| 3 | PF01235.19 | 0.7 | 7 | 1898 | same-strand | Sodium:alanine symporter family |
| 4 | PF00150.20 | 1.0 | 10 | 77.0 | same-strand | Cellulase (glycosyl hydrolase family 5) |
| 5 | PF00942.20 | 1.0 | 10 | 77.0 | same-strand | Cellulose binding domain |
++ More..