Result : Q45063
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein YneR |
| NCBI Accession ID | Z73234.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 13221 |
| Right | 13508 |
| Strand | - |
| Nucleotide Sequence | ATGAATATGACAATTAACGAAGACGCATTGAACTGGTATAAAGAAGAACTCGATTTGGAAAGCGGAGACCAGGTTCGCTTTTTCGTCCGCTATGGAGGCTGCAGCAACGTTCAAAAGGGTTTTTCTCTCGGTGTAGCGAAAGATGCCCCACAAGAGGCTGGAGTCACTGCAGAAGCTGATGGCATTACCTTCTTTATTGAAGAAAGTGATTTATGGTACTTTGATAACCACGACCTTCTCGTCAGCTATTCAGAAGACGCTGATGAACCGGTTTTTGAATACCAATAA |
| Sequence | MNMTINEDALNWYKEELDLESGDQVRFFVRYGGCSNVQKGFSLGVAKDAPQEAGVTAEADGITFFIEESDLWYFDNHDLLVSYSEDADEPVFEYQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00400. Profile Description: Iron-sulphur cluster biosynthesis. Proteins in this subfamily appear to be associated with the process of FeS-cluster assembly. The HesB proteins are associated with the nif gene cluster and the Rhizobium gene IscN has been shown to be required for nitrogen fixation. Nitrogenase includes multiple FeS clusters and many genes for their assembly. The E. coli SufA protein is associated with SufS, a NifS homolog and SufD which are involved in the FeS cluster assembly of the FhnF protein. The Azotobacter protein IscA (homologs of which are also found in E.coli) is associated which IscS, another NifS homolog and IscU, a nifU homolog as well as other factors consistent with a role in FeS cluster chemistry. A homolog from Geobacter contains a selenocysteine in place of an otherwise invariant cysteine, further suggesting a role in redox chemistry. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other] |
| Pubmed ID | 8969507 9384377 |
| Domain | CDD:412359 |
| Functional Category | Others |
| Uniprot ID | Q45063 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 52
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1931545 | 1931832 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2044514 | 2044801 | - | NZ_CP033052.1 | Bacillus vallismortis |
| 3 | 1839861 | 1840148 | - | NZ_CP013984.1 | Bacillus inaquosorum |
| 4 | 1895430 | 1895717 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 5 | 1893624 | 1893911 | - | NZ_CP048852.1 | Bacillus tequilensis |
| 6 | 38566 | 38853 | + | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1858747 | 1859034 | - | NZ_CP051464.1 | Bacillus mojavensis |
| 8 | 1993132 | 1993419 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 9 | 2043760 | 2044047 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
| 10 | 2175651 | 2175938 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
| 11 | 3534519 | 3534806 | + | NZ_CP043404.1 | Bacillus safensis |
| 12 | 3544539 | 3544826 | + | NZ_CP017786.1 | Bacillus xiamenensis |
| 13 | 1780983 | 1781270 | - | NZ_CP011150.1 | Bacillus altitudinis |
| 14 | 1880579 | 1880866 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 15 | 2074966 | 2075253 | + | NZ_CP011937.1 | Bacillus velezensis |
| 16 | 2165867 | 2166169 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 17 | 2869516 | 2869803 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 18 | 2521637 | 2521927 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 19 | 1963662 | 1963949 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 20 | 2189008 | 2189298 | - | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 21 | 2430618 | 2430905 | + | NZ_CP018866.1 | Sutcliffiella cohnii |
| 22 | 1496786 | 1497073 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 23 | 3057146 | 3057436 | + | NZ_CP017703.1 | Aeribacillus pallidus |
| 24 | 1444007 | 1444294 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 25 | 1781108 | 1781398 | + | NZ_CP014342.1 | Geobacillus subterraneus |
| 26 | 4618669 | 4618959 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 27 | 1754476 | 1754766 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 28 | 2350298 | 2350588 | + | NZ_CP024109.1 | Bacillus cytotoxicus |
| 29 | 2064245 | 2064538 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 30 | 2293476 | 2293769 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 31 | 2376880 | 2377167 | - | NZ_LS483476.1 | Lederbergia lentus |
| 32 | 1695814 | 1696107 | - | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 33 | 1780618 | 1780905 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 34 | 2339554 | 2339844 | + | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 35 | 1601304 | 1601594 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 36 | 1079925 | 1080215 | - | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 37 | 2628345 | 2628635 | - | NZ_CP053989.1 | Niallia circulans |
| 38 | 2379784 | 2380071 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 39 | 491115 | 491396 | - | NZ_AP017312.1 | Aneurinibacillus soli |
| 40 | 778879 | 779169 | - | NZ_CP061470.1 | Geobacillus zalihae |
| 41 | 376281 | 376574 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 42 | 2154653 | 2154952 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 43 | 1610573 | 1610863 | + | NZ_CP016540.2 | Planococcus versutus |
| 44 | 3634691 | 3634981 | + | NC_011725.1 | Bacillus cereus B4264 |
| 45 | 1541185 | 1541475 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 46 | 1635191 | 1635481 | - | NZ_CP019401.1 | Planococcus faecalis |
| 47 | 1502342 | 1502632 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 48 | 3128087 | 3128383 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 49 | 1596407 | 1596697 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 50 | 147113 | 147403 | + | NZ_CP013661.2 | Planococcus kocurii |
| 51 | 2173024 | 2173320 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 52 | 3720362 | 3720661 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08177.13 | 0.69 | 36 | 1511.0 | opposite-strand | Small acid-soluble spore protein N family |
| 2 | PF19824.1 | 0.73 | 38 | 1179.0 | opposite-strand | Small, acid-soluble spore protein Tlp |
| 3 | PF03061.24 | 0.88 | 46 | 348 | opposite-strand | Thioesterase superfamily |
| 4 | PF13279.8 | 0.88 | 46 | 355.0 | opposite-strand | Thioesterase-like superfamily |
| 5 | PF02660.17 | 0.65 | 34 | 97.5 | same-strand | Glycerol-3-phosphate acyltransferase |
++ More..