Result : Q45060
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Small, acid-soluble spore protein Tlp |
| NCBI Accession ID | Z73234.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 12123 |
| Right | 12374 |
| Strand | + |
| Nucleotide Sequence | ATGACAAAGAACCAAAATCAATATCAGCAGCCTAATCCTGATGATCGTTCTGACAATGTGGAAAAATTGCAGGATATGGTTCAAAATACAATTGAAAATATAGAAGAAGCAGAAGCATCAATGGAGTTTGCTTCAGGAGAAGATAAACAGCGTATCAAAGAAAAAAATGCAAGGCGCGAACAGAGCATTGAAGCGTTTCGTAATGAAATACAGGACGAATCTGCAGCGAGACAAAACGGATACCGTTCTTAA |
| Sequence | MTKNQNQYQQPNPDDRSDNVEKLQDMVQNTIENIEEAEASMEFASGEDKQRIKEKNARREQSIEAFRNEIQDESAARQNGYRS |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl07951. Profile Description: N/A. This protein family is restricted to a subset of endospore-forming bacteria such as Bacillus subtilis, all of which are in the Firmicutes (low-GC Gram-positive) lineage. Although previously designated tlp (thioredoxin-like protein), the B. subtilis protein was shown to be a minor small acid-soluble spore protein SASP, unique to spores. The motif E[VIL]XDE near the C-terminus probably represents at a germination protease cleavage site. [Cellular processes, Sporulation and germination] |
| Pubmed ID | 8969507 9384377 9852018 10333516 |
| Domain | CDD:186720 |
| Functional Category | Others |
| Uniprot ID | Q45060 |
| ORF Length (Amino Acid) | 83 |
++ More..
| Conservation Analysis |
No. of Species: 60
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1930447 | 1930698 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 1894333 | 1894584 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 3 | 1892527 | 1892778 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 4 | 2043419 | 2043670 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 5 | 1857651 | 1857902 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 6 | 39696 | 39947 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 7 | 1838760 | 1839014 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 8 | 2076103 | 2076345 | - | NZ_CP011937.1 | Bacillus velezensis |
| 9 | 1879486 | 1879728 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 10 | 1962083 | 1962316 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 11 | 2871177 | 2871410 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 12 | 1779135 | 1779365 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 13 | 2172947 | 2173186 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 14 | 2167287 | 2167532 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 15 | 4622241 | 4622483 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 16 | 1782689 | 1782916 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 17 | 1498401 | 1498634 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 18 | 1989775 | 1990011 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 19 | 2431993 | 2432232 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 20 | 777356 | 777583 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 21 | 2341150 | 2341377 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 22 | 2524011 | 2524253 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 23 | 3946081 | 3946314 | - | NZ_CP053989.1 | Niallia circulans |
| 24 | 1444835 | 1445059 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 25 | 2040359 | 2040595 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 26 | 1078393 | 1078620 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 27 | 1967725 | 1967952 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 28 | 3535691 | 3535933 | - | NZ_CP043404.1 | Bacillus safensis |
| 29 | 1599772 | 1599999 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 30 | 1779861 | 1780103 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 31 | 325138 | 325380 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 32 | 3545707 | 3545949 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 33 | 2185501 | 2185737 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 34 | 2289970 | 2290221 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 35 | 2378098 | 2378340 | - | NZ_LS483476.1 | Lederbergia lentus |
| 36 | 3721822 | 3722046 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 37 | 1940534 | 1940749 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 38 | 1687673 | 1687903 | - | NZ_CP012024.1 | Bacillus smithii |
| 39 | 762398 | 762634 | + | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 40 | 662431 | 662652 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 41 | 375052 | 375282 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 42 | 3058633 | 3058854 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 43 | 2065423 | 2065650 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 44 | 847830 | 848054 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 45 | 2171636 | 2171866 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 46 | 2352460 | 2352672 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 47 | 5000072 | 5000323 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 48 | 2319884 | 2320114 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 49 | 2142932 | 2143153 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 50 | 152782 | 152994 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 51 | 3752187 | 3752414 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 52 | 2341510 | 2341737 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 53 | 1528029 | 1528256 | - | NZ_CP016786.1 | Clostridium isatidis |
| 54 | 346436 | 346690 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 55 | 1811439 | 1811675 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 56 | 396742 | 397005 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 57 | 332236 | 332493 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 58 | 1998207 | 1998464 | + | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 59 | 284268 | 284525 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 60 | 3498843 | 3499070 | - | NZ_AP019400.1 | Cohnella abietis |
| 61 | 2957601 | 2957825 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000964.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00578.23 | 0.72 | 43 | 483 | same-strand | AhpC/TSA family |
| 2 | PF08534.12 | 0.72 | 43 | 483 | same-strand | Redoxin |
| 3 | PF13905.8 | 0.72 | 43 | 483 | same-strand | Thioredoxin-like |
| 4 | PF13098.8 | 0.67 | 40 | 483.0 | same-strand | Thioredoxin-like domain |
| 5 | PF13040.8 | 0.7 | 42 | 246.5 | same-strand | Fur-regulated basic protein B |
| 6 | PF08177.13 | 0.67 | 40 | 37.0 | same-strand | Small acid-soluble spore protein N family |
| 7 | PF03061.24 | 0.8 | 48 | 118 | same-strand | Thioesterase superfamily |
| 8 | PF13279.8 | 0.8 | 48 | 116.0 | same-strand | Thioesterase-like superfamily |
++ More..