Result : Q44906
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Flagellar biosynthetic protein FliQ |
| NCBI Accession ID | U43739.1 |
| Organism | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) |
| Left | 8800 |
| Right | 9063 |
| Strand | - |
| Nucleotide Sequence | ATGACTGCAGGACACATTCTTTATTTAATTAGAATTTCTATTGAAAACATTATTATTTTATCAGCCCCAATGTTGATTATAGCTCTTATAGTTGGTCTTTTGATTTCAATTTTTCAAGCCATTACTTCAATTCAAGATCAAACTTTGAGTTTTATTCCAAAGATTATTGTTATACTTTTAGTTATTGTGATTTTTGGTCCTTGGATTTTGAATAAGCTTATGCAGTTTACCTATATGATTTTTAGTCAATTGCAAAATGTTTAA |
| Sequence | MTAGHILYLIRISIENIIILSAPMLIIALIVGLLISIFQAITSIQDQTLSFIPKIIVILLVIVIFGPWILNKLMQFTYMIFSQLQNV |
| Source of smORF | Swiss-Prot |
| Function | Role in flagellar biosynthesis. |
| Pubmed ID | 9403685 |
| Domain | CDD:412617 |
| Functional Category | Others |
| Uniprot ID | Q44906 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 87
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 286475 | 286738 | - | NC_015921.1 | Borreliella bissettii DN127 |
| 2 | 288703 | 288966 | - | NZ_CP015796.1 | Borreliella mayonii |
| 3 | 286512 | 286775 | - | NZ_CP044535.1 | Borrelia maritima |
| 4 | 287401 | 287664 | - | NZ_CP028861.1 | Borreliella garinii |
| 5 | 290633 | 290896 | - | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 6 | 617356 | 617619 | + | NZ_CP024333.1 | Borrelia miyamotoi |
| 7 | 309854 | 310093 | - | NC_011244.1 | Borrelia recurrentis A1 |
| 8 | 297425 | 297688 | - | NZ_CP028884.1 | Borrelia turcica IST7 |
| 9 | 289809 | 290072 | - | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 10 | 289921 | 290184 | - | NC_008710.1 | Borrelia turicatae 91E135 |
| 11 | 283643 | 283906 | - | NZ_CP013704.1 | Borrelia anserina Es |
| 12 | 1088847 | 1089116 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 13 | 834480 | 834749 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 14 | 4735281 | 4735550 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 15 | 1279875 | 1280144 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 16 | 6144683 | 6144952 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 17 | 234644 | 234913 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 18 | 216199 | 216468 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 19 | 1282791 | 1283060 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 20 | 1543983 | 1544252 | - | NZ_CP013661.2 | Planococcus kocurii |
| 21 | 2558656 | 2558925 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 22 | 207751 | 208020 | + | NZ_CP016540.2 | Planococcus versutus |
| 23 | 221105 | 221374 | + | NZ_CP019401.1 | Planococcus faecalis |
| 24 | 226944 | 227213 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 25 | 1531593 | 1531862 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 26 | 2376268 | 2376537 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 27 | 4691879 | 4692148 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 28 | 3950301 | 3950570 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 29 | 3544092 | 3544361 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 30 | 860940 | 861209 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 31 | 4028936 | 4029205 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 32 | 1546096 | 1546365 | + | NZ_LR699011.1 | Roseburia hominis |
| 33 | 1090137 | 1090406 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 34 | 3337369 | 3337638 | + | NZ_CP034437.1 | Paenibacillus albus |
| 35 | 229957 | 230226 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 36 | 227455 | 227724 | + | NZ_CP016538.2 | Planococcus maritimus |
| 37 | 228023 | 228292 | + | NZ_CP059540.1 | Planococcus maritimus |
| 38 | 3417729 | 3417998 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 39 | 3623514 | 3623783 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 40 | 3407224 | 3407445 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 41 | 2420478 | 2420723 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 42 | 1787645 | 1787914 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 43 | 1086555 | 1086824 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 44 | 1092647 | 1092916 | + | NZ_CP033433.1 | Cohnella candidum |
| 45 | 3800805 | 3801074 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 46 | 2174282 | 2174503 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 47 | 2242510 | 2242779 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 48 | 3119951 | 3120220 | - | NZ_CP009788.1 | Geobacter pickeringii |
| 49 | 399355 | 399624 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 50 | 3877665 | 3877934 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 51 | 4407841 | 4408110 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 52 | 3454191 | 3454460 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 53 | 907433 | 907702 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 54 | 2205373 | 2205630 | + | NZ_CP053989.1 | Niallia circulans |
| 55 | 3744692 | 3744913 | - | NZ_CP009288.1 | Paenibacillus durus |
| 56 | 3689687 | 3689908 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 57 | 607693 | 607908 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 58 | 6265919 | 6266140 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 59 | 4725436 | 4725657 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 60 | 6126495 | 6126716 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 61 | 4193860 | 4194081 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 62 | 4914547 | 4914768 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 63 | 3956630 | 3956899 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 64 | 2792052 | 2792267 | - | NC_017080.1 | Phycisphaera mikurensis NBRC 102666 |
| 65 | 989798 | 990067 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 66 | 3226649 | 3226870 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 67 | 4136867 | 4137136 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 68 | 1378957 | 1379226 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 69 | 1455866 | 1456135 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 70 | 1692131 | 1692400 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 71 | 61445 | 61714 | + | NC_002967.9 | Treponema denticola ATCC 35405 |
| 72 | 1144908 | 1145156 | + | NZ_CP045571.1 | Acidithiobacillus thiooxidans ATCC 19377 |
| 73 | 799225 | 799494 | - | NZ_CP009228.1 | Treponema putidum |
| 74 | 495135 | 495404 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 75 | 1356495 | 1356764 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 76 | 6339779 | 6339997 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 77 | 348742 | 349011 | + | NZ_AP014945.1 | Caldimicrobium thiodismutans |
| 78 | 1267809 | 1268078 | + | NC_023035.1 | Salinispira pacifica |
| 79 | 419749 | 420000 | + | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 80 | 2852572 | 2852841 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 81 | 3315244 | 3315471 | + | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 82 | 6197128 | 6197397 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 83 | 1077568 | 1077837 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 84 | 1118712 | 1118984 | + | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 85 | 115269 | 115481 | - | NZ_CP029495.1 | Chromobacterium phragmitis |
| 86 | 2164323 | 2164553 | - | NZ_CP043473.1 | Chromobacterium paludis |
| 87 | 1415869 | 1416081 | - | NZ_CP017707.1 | Chromobacterium vaccinii |
| 88 | 1512069 | 1512335 | + | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015921.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13614.8 | 0.83 | 72 | 5268 | same-strand | AAA domain |
| 2 | PF10609.11 | 0.61 | 53 | 5225.0 | same-strand | NUBPL iron-transfer P-loop NTPase |
| 3 | PF01656.25 | 0.83 | 72 | 5253 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 4 | PF00448.24 | 0.85 | 74 | 3963 | same-strand | SRP54-type protein, GTPase domain |
| 5 | PF00771.22 | 0.89 | 77 | 1932.5 | same-strand | FHIPEP family |
| 6 | PF01312.21 | 0.9 | 78 | 810 | same-strand | FlhB HrpN YscU SpaS Family |
| 7 | PF01311.22 | 0.97 | 84 | 10 | same-strand | Bacterial export proteins, family 1 |
| 8 | PF00813.22 | 0.94 | 82 | 24 | same-strand | FliP family |
| 9 | PF01052.22 | 0.94 | 82 | 1805 | same-strand | Type III flagellar switch regulator (C-ring) FliN C-term |
| 10 | PF02154.17 | 0.92 | 80 | 2719.0 | same-strand | Flagellar motor switch protein FliM |
++ More..