Result : Q44754
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein BB_0266 (ORF38) |
| NCBI Accession ID | AE000783.1 |
| Organism | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) |
| Left | 279078 |
| Right | 279380 |
| Strand | - |
| Nucleotide Sequence | ATGGATACATTTGAAGTTTTTAAAATGTCTGTTGTTGGATCTTTTAAAGCTAGACAATTTTTAAGTGAAAGTGAAAAGCACAAAAGATTAAAAATTAATCAAAATGCTAGATTTAGATTTTTAAGAGATTGTCATACTGATTCTGAGGTTGGCAATGTATGTGTAGTTAATAAAGTAGGGGATAATTATTTGCTTTCGTTTCCAGTTAAAAAAAATAAAAATGAAGAGAAGGTGATGCTTAGTTTATATCCTGATAAATTTGAAGATCCTAAAATTGGTAAAAATGTTAATATTAAGAGATAA |
| Sequence | MDTFEVFKMSVVGSFKARQFLSESEKHKRLKINQNARFRFLRDCHTDSEVGNVCVVNKVGDNYLLSFPVKKNKNEEKVMLSLYPDKFEDPKIGKNVNIKR |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 9403685 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q44754 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 279871 | 280173 | - | NZ_CP015796.1 | Borreliella mayonii |
| 2 | 277643 | 277945 | - | NC_015921.1 | Borreliella bissettii DN127 |
| 3 | 277694 | 277996 | - | NZ_CP044535.1 | Borrelia maritima |
| 4 | 278565 | 278867 | - | NZ_CP028861.1 | Borreliella garinii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP015796.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00515.30 | 0.75 | 3 | 3842 | opposite-strand | Tetratricopeptide repeat |
| 2 | PF12895.9 | 1.0 | 4 | 3841.0 | opposite-strand | Anaphase-promoting complex, cyclosome, subunit 3 |
| 3 | PF01551.24 | 1.0 | 4 | 2580.0 | same-strand | Peptidase family M23 |
| 4 | PF01476.22 | 1.0 | 4 | 2580.0 | same-strand | LysM domain |
| 5 | PF10502.11 | 1.0 | 4 | 2011.0 | opposite-strand | Signal peptidase, peptidase S26 |
| 6 | PF06723.15 | 1.0 | 4 | 519.0 | same-strand | MreB/Mbl protein |
| 7 | PF03961.15 | 1.0 | 4 | 27.0 | same-strand | Flagellar Assembly Protein A |
| 8 | PF14804.8 | 1.0 | 4 | 27.0 | same-strand | Jag N-terminus |
| 9 | PF13614.8 | 1.0 | 4 | 2420.0 | same-strand | AAA domain |
| 10 | PF10609.11 | 1.0 | 4 | 2420.0 | same-strand | NUBPL iron-transfer P-loop NTPase |
| 11 | PF01656.25 | 1.0 | 4 | 2420.0 | same-strand | CobQ/CobB/MinD/ParA nucleotide binding domain |
| 12 | PF00448.24 | 1.0 | 4 | 3319.0 | same-strand | SRP54-type protein, GTPase domain |
| 13 | PF00771.22 | 1.0 | 4 | 4489.0 | same-strand | FHIPEP family |
++ More..