Result : Q44491
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0437 protein Ava_4254 |
| NCBI Accession ID | U49859.1 |
| Organism | Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis) |
| Left | 12591 |
| Right | 12851 |
| Strand | + |
| Nucleotide Sequence | ATGAGGAGTATTATGGTGCAGTCAGCCAAAACAGATTCTGTCAATCAACAGACGATTGAAGGGTTAAAACTACAAATTAAGAAACTGAACAGTAAGGCTGGTCAATTGAAGATGGATCTGCATGATTTGGCTGAAGGTTTGCCAATTGATTACCAAAATTTGACTGCACTAGCAGCCGAAACTTATGAAATCTATCGTCATTTAGATGAATTAAAGTCTCAGCTAAAAAGTTTGGAGAAAAATCATGACATGGGATATTGA |
| Sequence | MRSIMVQSAKTDSVNQQTIEGLKLQIKKLNSKAGQLKMDLHDLAEGLPIDYQNLTALAAETYEIYRHLDELKSQLKSLEKNHDMGY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02247. Profile Description: Rop-like. This family contains several uncharacterized bacterial proteins. These proteins are found in nitrogen fixation operons so are likely to play some role in this process. They consist of two alpha helices which are joined by a four residue linker. The helices form an antiparallel bundle and cross towards their termini. They are likely to form a rod-like dimer. They have structural similarity to the regulatory protein Rop, pfam01815. |
| Pubmed ID | 7568132 25197444 |
| Domain | CDD:413246 |
| Functional Category | Others |
| Uniprot ID | Q44491 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 269745 | 270005 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 2 | 6202717 | 6202932 | + | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 3 | 3777678 | 3777914 | + | NC_019689.1 | Pleurocapsa sp. PCC 7327 |
| 4 | 5145874 | 5146104 | - | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
| 5 | 2363740 | 2363976 | - | NC_011729.1 | Gloeothece citriformis PCC 7424 |
| 6 | 4085058 | 4085294 | + | NC_014501.1 | Gloeothece verrucosa PCC 7822 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP047242.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00148.21 | 1.0 | 5 | 1673 | same-strand | Nitrogenase component 1 type Oxidoreductase |
| 2 | PF02579.19 | 1.0 | 5 | 608.0 | same-strand | Dinitrogenase iron-molybdenum cofactor |
| 3 | PF03270.15 | 1.0 | 5 | 63.0 | same-strand | Protein of unknown function, DUF269 |
| 4 | PF03206.16 | 1.0 | 5 | -9.5 | same-strand | Nitrogen fixation protein NifW |
| 5 | PF00899.23 | 1.0 | 5 | 332.0 | same-strand | ThiF family |
| 6 | PF01521.22 | 1.0 | 5 | 1217.5 | same-strand | Iron-sulphur cluster biosynthesis |
| 7 | PF00111.29 | 1.0 | 5 | 1736.0 | same-strand | 2Fe-2S iron-sulfur cluster binding domain |
++ More..