Result : Q44361
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Conjugal transfer protein TraD |
| NCBI Accession ID | |
| Organism | Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) |
| Left | |
| Right | |
| Strand | |
| Nucleotide Sequence | |
| Sequence | MSKAMTSDARKKDTREKIELGGLIVKAGLRYEKRALLLGLLIDGERRLKGDEDERSRLTAIGVEAFGHDGE |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl05753. Profile Description: Conjugal transfer protein TraD. This family contains bacterial TraD conjugal transfer proteins. Mutations in the TraD gene result in loss of transfer. |
| Pubmed ID | 8763954 |
| Domain | CDD:414526 |
| Functional Category | Others |
| Uniprot ID | Q44361 |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 17
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 290112 | 290327 | - | NZ_CP071608.1 | Rhizobium binae |
| 2 | 150832 | 151047 | + | NZ_CP071609.1 | Rhizobium binae |
| 3 | 402851 | 403066 | - | NZ_CP017943.1 | Phyllobacterium zundukense |
| 4 | 54652 | 54867 | - | NZ_LR723673.1 | Pseudorhizobium flavum |
| 5 | 250401 | 250616 | - | NZ_CP071615.1 | Rhizobium bangladeshense |
| 6 | 42501 | 42716 | + | NZ_CP013109.1 | Sinorhizobium americanum |
| 7 | 130452 | 130667 | - | NZ_LR723671.1 | Pseudorhizobium flavum |
| 8 | 430422 | 430637 | - | NZ_CP041240.1 | Ensifer mexicanus |
| 9 | 66070 | 66285 | - | NZ_CP049245.1 | Rhizobium pseudoryzae |
| 10 | 525769 | 525984 | - | NC_020061.1 | Rhizobium tropici CIAT 899 |
| 11 | 192770 | 192985 | - | NC_020060.1 | Rhizobium tropici CIAT 899 |
| 12 | 410972 | 411187 | - | NZ_CP041239.1 | Ensifer mexicanus |
| 13 | 527739 | 527954 | - | NZ_CP032696.1 | Rhizobium jaguaris |
| 14 | 519608 | 519823 | - | NZ_CP020910.1 | Rhizobium etli |
| 15 | 1437501 | 1437716 | + | NZ_CP015882.1 | Ensifer adhaerens |
| 16 | 268787 | 269002 | + | NZ_CP048637.1 | Rhizobium oryzihabitans |
| 17 | 193769 | 193984 | - | NZ_CP006878.1 | Rhizobium gallicum bv. gallicum R602sp |
| 18 | 166077 | 166292 | + | NZ_CP071682.1 | Rhizobium ruizarguesonis |
| 19 | 120800 | 121015 | - | NC_007961.1 | Nitrobacter hamburgensis X14 |
| 20 | 14205 | 14420 | - | NZ_LT960615.1 | Hartmannibacter diazotrophicus |
| 21 | 483623 | 483838 | - | NZ_CP006879.1 | Rhizobium gallicum bv. gallicum R602sp |
| 22 | 110010 | 110225 | - | NC_015689.1 | Afipia carboxidovorans OM5 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP071609.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02534.16 | 1.0 | 17 | -13.0 | same-strand | Type IV secretory system Conjugative DNA transfer |
| 2 | PF12696.9 | 1.0 | 17 | -13.0 | same-strand | TraM recognition site of TraD and TraG |
| 3 | PF07820.14 | 0.94 | 16 | 5 | same-strand | TraC-like protein |
| 4 | PF03389.17 | 0.88 | 15 | 556.5 | opposite-strand | MobA/MobL family |
| 5 | PF13604.8 | 0.88 | 15 | 556.5 | opposite-strand | AAA domain |
| 6 | PF17841.3 | 0.82 | 14 | 556 | opposite-strand | BID domain of Bartonella effector protein (Bep) |
| 7 | PF13245.8 | 0.88 | 15 | 556.5 | opposite-strand | AAA domain |
| 8 | PF13538.8 | 0.88 | 15 | 557 | opposite-strand | UvrD-like helicase C-terminal domain |
| 9 | PF10502.11 | 0.76 | 13 | 3865 | opposite-strand | Signal peptidase, peptidase S26 |
| 10 | PF00795.24 | 0.82 | 14 | 4421.0 | opposite-strand | Carbon-nitrogen hydrolase |
| 11 | PF06871.13 | 0.71 | 12 | 5600.0 | opposite-strand | TraH 2 |
++ More..