Protein Information |
Information Type | Description |
---|---|
Protein name | Conjugal transfer protein TraC |
NCBI Accession ID | AF010180.1 |
Organism | Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) |
Left | 2684 |
Right | 2980 |
Strand | - |
Nucleotide Sequence | ATGAAGAAACCATCATCGAAGATCAGGGAAGAAATTGCCAGATTGCAGGACCAGCTGAAACAGGCCGAAACACGCGAGGCCGAACGAATCGGCAGGATTGCGTTGAAGGCCGGTCTTGGTGAAATCGACATCGAGGAGTCACAGCTTCAGGCAGCCTTCGAGGAAGTCGCCAAACGGTTTCGTGGCGGCAAGGGCTCGGCGACCGGAAAGAGACAAGCCGGAGAGAGCCGGACCGGTACCGAGCCGTCCGCGGCGCTCGCGTCTGGCGCGGATGAAGGCGGGTCTGGCGAGGCTTGA |
Sequence | MKKPSSKIREEIARLQDQLKQAETREAERIGRIALKAGLGEIDIEESQLQAAFEEVAKRFRGGKGSATGKRQAGESRTGTEPSAALASGADEGGSGEA |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl06725. Profile Description: TraC-like protein. conjugal transfer protein TraC; Provisional |
Pubmed ID | 8763953 11743193 11743194 |
Domain | CDD:384654 |
Functional Category | Others |
Uniprot ID | Q44348 |
ORF Length (Amino Acid) | 98 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 54872 | 55168 | - | NZ_LR723673.1 | Pseudorhizobium flavum |
2 | 403071 | 403367 | - | NZ_CP017943.1 | Phyllobacterium zundukense |
3 | 130672 | 130968 | - | NZ_LR723671.1 | Pseudorhizobium flavum |
4 | 268486 | 268782 | + | NZ_CP048637.1 | Rhizobium oryzihabitans |
5 | 525989 | 526285 | - | NC_020061.1 | Rhizobium tropici CIAT 899 |
6 | 483843 | 484139 | - | NZ_CP006879.1 | Rhizobium gallicum bv. gallicum R602sp |
7 | 527959 | 528255 | - | NZ_CP032696.1 | Rhizobium jaguaris |
8 | 430642 | 430938 | - | NZ_CP041240.1 | Ensifer mexicanus |
9 | 165776 | 166072 | + | NZ_CP071682.1 | Rhizobium ruizarguesonis |
10 | 66290 | 66586 | - | NZ_CP049245.1 | Rhizobium pseudoryzae |
11 | 1437194 | 1437496 | + | NZ_CP015882.1 | Ensifer adhaerens |
12 | 250621 | 250917 | - | NZ_CP071615.1 | Rhizobium bangladeshense |
13 | 42200 | 42496 | + | NZ_CP013109.1 | Sinorhizobium americanum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02534.16 | 1.0 | 12 | 207 | same-strand | Type IV secretory system Conjugative DNA transfer |
2 | PF12696.9 | 1.0 | 12 | 207 | same-strand | TraM recognition site of TraD and TraG |
3 | PF06412.13 | 1.0 | 12 | 5 | same-strand | Conjugal transfer protein TraD |
4 | PF03389.17 | 0.92 | 11 | 255.0 | opposite-strand | MobA/MobL family |
5 | PF13604.8 | 0.92 | 11 | 255.0 | opposite-strand | AAA domain |
6 | PF17841.3 | 0.83 | 10 | 255 | opposite-strand | BID domain of Bartonella effector protein (Bep) |
7 | PF13245.8 | 0.92 | 11 | 255.0 | opposite-strand | AAA domain |
8 | PF13538.8 | 0.83 | 10 | 255 | opposite-strand | UvrD-like helicase C-terminal domain |
9 | PF10502.11 | 0.83 | 10 | 3563 | opposite-strand | Signal peptidase, peptidase S26 |
10 | PF00795.24 | 0.83 | 10 | 4120 | opposite-strand | Carbon-nitrogen hydrolase |
11 | PF06871.13 | 0.75 | 9 | 5299.0 | opposite-strand | TraH 2 |