Result : Q3ZZU2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | AJ965256.1 |
| Organism | Dehalococcoides mccartyi (strain CBDB1) |
| Left | 435485 |
| Right | 435715 |
| Strand | + |
| Nucleotide Sequence | GTGGAAGCTGATGTAATCAAACTCTTAGCGGCTGGCCTGGCAATGGGTCTGGGTGCAATTGGCCCCGGTATCGGTGTAGGTATTCTGGGTTTTGGTGCTTTGCAGGCTATCGGCCGCAATCCTGAAGCCAAGGGTTCTATCTTCACCAACATGATCCTTTTGGTGGCTTTCGCTGAGTCCATCGCCATCTTTGCGCTGGTTATCTCTATCGTACTTATTTTCGTTGCCTAA |
| Sequence | MEADVIKLLAAGLAMGLGAIGPGIGVGILGFGALQAIGRNPEAKGSIFTNMILLVAFAESIAIFALVISIVLIFVA |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | 16116419 |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | Q3ZZU2 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 71
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 465559 | 465789 | + | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 2 | 810169 | 810399 | - | NZ_CP018258.1 | Dehalogenimonas formicexedens |
| 3 | 1640236 | 1640469 | - | NC_009767.1 | Roseiflexus castenholzii DSM 13941 |
| 4 | 5405402 | 5405590 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 5 | 1569075 | 1569287 | - | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 6 | 53298 | 53501 | + | NZ_CP025057.1 | Spiroplasma floricola 23-6 |
| 7 | 52197 | 52445 | + | NZ_CP012622.1 | Spiroplasma cantharicola |
| 8 | 3006034 | 3006249 | + | NC_019675.1 | Cyanobium gracile PCC 6307 |
| 9 | 47028 | 47297 | + | NZ_CP012328.1 | Spiroplasma turonicum |
| 10 | 1485699 | 1485917 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 11 | 51000 | 51212 | + | NC_021833.1 | Spiroplasma diminutum CUAS-1 |
| 12 | 1463765 | 1464013 | - | NC_005042.1 | Prochlorococcus marinus subsp. marinus str. CCMP1375 |
| 13 | 944391 | 944600 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 14 | 46893 | 47099 | + | NZ_CP012357.1 | Spiroplasma litorale |
| 15 | 50776 | 50979 | + | NZ_CP025543.1 | Spiroplasma monobiae MQ-1 |
| 16 | 2131485 | 2131730 | + | NC_019729.1 | Oscillatoria nigro-viridis PCC 7112 |
| 17 | 781507 | 781770 | - | NZ_CP024965.1 | Entomoplasma somnilux |
| 18 | 766262 | 766450 | - | NZ_CP014334.1 | Fervidobacterium islandicum |
| 19 | 634518 | 634745 | - | NC_017079.1 | Caldilinea aerophila DSM 14535 = NBRC 104270 |
| 20 | 429493 | 429702 | - | NZ_CP061799.1 | Desulfonema limicola |
| 21 | 2566334 | 2566558 | - | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 22 | 133276 | 133479 | + | NZ_CP024969.1 | Mesoplasma tabanidae |
| 23 | 3749867 | 3750079 | - | NC_014393.1 | Clostridium cellulovorans 743B |
| 24 | 2162302 | 2162487 | - | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 25 | 137742 | 137993 | + | NZ_CP024411.1 | Mesoplasma entomophilum |
| 26 | 2348487 | 2348741 | - | NC_022600.1 | Gloeobacter kilaueensis JS1 |
| 27 | 1912923 | 1913120 | - | NC_011899.1 | Halothermothrix orenii H 168 |
| 28 | 800009 | 800242 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 29 | 135042 | 135293 | + | NC_006055.1 | Mesoplasma florum L1 |
| 30 | 2954702 | 2954953 | + | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 31 | 1537006 | 1537194 | - | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 32 | 2593559 | 2593747 | - | NZ_CP016379.1 | Anoxybacter fermentans |
| 33 | 645014 | 645253 | - | NZ_CP023668.1 | Mesoplasma lactucae ATCC 49193 |
| 34 | 77518 | 77754 | + | NZ_CP024870.1 | Spiroplasma clarkii |
| 35 | 3189649 | 3189861 | - | NZ_AP019309.1 | Intestinibaculum porci |
| 36 | 620902 | 621126 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 37 | 2400151 | 2400399 | + | NZ_AP018449.1 | Methylomusa anaerophila |
| 38 | 95237 | 95491 | + | NC_007633.1 | Mycoplasma capricolum subsp. capricolum ATCC 27343 |
| 39 | 3417756 | 3417962 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 40 | 940784 | 941038 | - | NZ_CP001668.1 | Mycoplasma mycoides subsp. capri str. GM12 |
| 41 | 1450485 | 1450745 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 42 | 3379171 | 3379359 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 43 | 2798067 | 2798255 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 44 | 1564655 | 1564843 | - | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 45 | 1558131 | 1558319 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 46 | 261024 | 261215 | + | NZ_LR214970.1 | Mycoplasmopsis bovigenitalium |
| 47 | 436117 | 436305 | - | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 48 | 147250 | 147486 | + | NZ_LR134523.1 | Peptoniphilus ivorii |
| 49 | 4401805 | 4401993 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 50 | 282906 | 283091 | - | NC_006908.1 | Mycoplasma mobile 163K |
| 51 | 6613825 | 6614016 | - | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 52 | 756382 | 756618 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 53 | 508531 | 508719 | + | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 54 | 3252303 | 3252512 | + | NZ_CP019646.1 | Limihaloglobus sulfuriphilus |
| 55 | 52449 | 52640 | - | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 56 | 313346 | 313564 | - | NC_018178.1 | Melioribacter roseus P3M-2 |
| 57 | 863194 | 863412 | + | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 58 | 103673 | 103858 | + | NZ_LR215041.1 | Mycoplasmopsis columbina |
| 59 | 199521 | 199772 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 60 | 1223370 | 1223591 | - | NC_011831.1 | Chloroflexus aggregans DSM 9485 |
| 61 | 1232347 | 1232568 | + | NZ_LT960614.1 | Hartmannibacter diazotrophicus |
| 62 | 276017 | 276202 | - | NZ_LR215043.1 | Mycoplasmopsis columbinasalis |
| 63 | 54390 | 54578 | + | NZ_CP006934.1 | Spiroplasma sabaudiense Ar-1343 |
| 64 | 782112 | 782318 | - | NZ_CP024962.1 | Entomoplasma freundtii |
| 65 | 2366837 | 2367025 | + | NZ_LS974202.1 | Mesotoga infera |
| 66 | 2496862 | 2497077 | - | NZ_HG917868.1 | Clostridium bornimense |
| 67 | 1113873 | 1114061 | - | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 68 | 692481 | 692669 | - | NC_017095.1 | Fervidobacterium pennivorans DSM 9078 |
| 69 | 2418995 | 2419213 | - | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 70 | 1234349 | 1234567 | + | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 71 | 2727253 | 2727465 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP006950.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00119.22 | 0.7 | 50 | 107.0 | same-strand | ATP synthase A chain |
| 2 | PF00430.20 | 0.8 | 57 | 33.0 | same-strand | ATP synthase B/B' CF(0) |
| 3 | PF00306.29 | 0.61 | 43 | 1176 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 4 | PF02874.25 | 0.77 | 55 | 1176.5 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
++ More..