Result : A7ZNS4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Transcriptional repressor RcnR homolog |
| NCBI Accession ID | CP000800.1 |
| Organism | Escherichia coli O139:H28 (strain E24377A / ETEC) |
| Left | 2367026 |
| Right | 2367298 |
| Strand | - |
| Nucleotide Sequence | ATGTCTCATACAATCCGTGATAAACAGAAACTGAAAGCGCGTGCCAGTAAGATTCAGGGCCAGGTCGTGGCGCTCAAGAAAATGCTCGACGAGCCGCACGAATGCGCTGCAGTTTTACAACAGATTGCTGCTATCCGTGGCGCGGTAAACGGTCTGATGCGGGAAGTGATTAAAGGTCATCTGACGGAACACATCGTTCACCAGGGGGATGAGCTAAAACGTGAAGAAGATCTGGATGTCGTTCTGAAGGTGCTGGATTCATATATCAAATAA |
| Sequence | MSHTIRDKQKLKARASKIQGQVVALKKMLDEPHECAAVLQQIAAIRGAVNGLMREVIKGHLTEHIVHQGDELKREEDLDVVLKVLDSYIK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00846. Profile Description: Transcriptional regulators CsoR (copper-sensitive operon repressor), RcnR, and FrmR, and related domains; this domain superfamily was previously known as DUF156. This is a family of metal-sensitive repressors, involved in resistance to metal ions. Members of this family bind copper, nickel or cobalt ions via conserved cysteine and histidine residues. In the absence of metal ions, these proteins bind to promoter regions and repress transcription. When bound to metal ions they are unable to bind DNA, leading to transcriptional derepression. |
| Pubmed ID | 18676672 |
| Domain | CDD:412603 |
| Functional Category | DNA-binding |
| Uniprot ID | A7ZNS4 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 102
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1614604 | 1614876 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 2 | 2729195 | 2729467 | - | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 2191046 | 2191318 | - | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 4 | 2185524 | 2185796 | - | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 5 | 2861374 | 2861646 | - | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 6 | 2185714 | 2185986 | - | NZ_AP014857.1 | Escherichia albertii |
| 7 | 3322141 | 3322413 | + | NZ_CP044098.1 | Citrobacter portucalensis |
| 8 | 220462 | 220734 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
| 9 | 1505840 | 1506112 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 10 | 3200912 | 3201184 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 11 | 1778292 | 1778564 | - | NZ_CP033744.1 | Citrobacter freundii |
| 12 | 3073280 | 3073552 | - | NC_013716.1 | Citrobacter rodentium ICC168 |
| 13 | 3926797 | 3927069 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 14 | 1905116 | 1905388 | + | NZ_LR134201.1 | Cedecea lapagei |
| 15 | 3183789 | 3184061 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 16 | 4290763 | 4291035 | + | NZ_CP038469.1 | Citrobacter tructae |
| 17 | 2172634 | 2172906 | - | NZ_CP023525.1 | Cedecea neteri |
| 18 | 878407 | 878679 | + | NZ_LR134475.1 | Klebsiella aerogenes |
| 19 | 251527 | 251799 | + | NZ_CP011601.1 | Phytobacter ursingii |
| 20 | 168204 | 168476 | + | NZ_CP061512.1 | Mixta calida |
| 21 | 3084311 | 3084583 | - | NZ_CP041247.1 | Raoultella electrica |
| 22 | 3514900 | 3515172 | - | NZ_CP050508.1 | Raoultella terrigena |
| 23 | 3243192 | 3243464 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 24 | 3963197 | 3963469 | + | NZ_CP026047.1 | Raoultella planticola |
| 25 | 1162810 | 1163082 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 26 | 1788059 | 1788331 | + | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 27 | 478181 | 478453 | + | NZ_CP011602.1 | Phytobacter ursingii |
| 28 | 3589917 | 3590189 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 29 | 1384988 | 1385260 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 30 | 3780805 | 3781077 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 31 | 1395541 | 1395813 | + | NZ_CP067057.1 | Rahnella aceris |
| 32 | 1831707 | 1831979 | - | NZ_CP050150.1 | Hafnia alvei |
| 33 | 4390011 | 4390283 | + | NZ_CP016337.1 | Kosakonia sacchari |
| 34 | 4429462 | 4429734 | + | NZ_CP045300.1 | Kosakonia arachidis |
| 35 | 2723307 | 2723579 | - | NZ_CP029822.1 | Entomomonas moraniae |
| 36 | 1202729 | 1203001 | - | NZ_CP015581.1 | Tatumella citrea |
| 37 | 4007597 | 4007869 | + | NZ_CP006664.1 | Edwardsiella anguillarum ET080813 |
| 38 | 3336229 | 3336501 | - | NZ_CP023706.1 | Edwardsiella tarda |
| 39 | 1677395 | 1677667 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 40 | 2143960 | 2144232 | - | NZ_CP028897.1 | Dongshaea marina |
| 41 | 1478776 | 1479048 | + | NZ_CP025793.1 | Vibrio jasicida 090810c |
| 42 | 876031 | 876303 | - | NZ_CP019960.1 | Vibrio owensii |
| 43 | 3720979 | 3721251 | - | NZ_CP061081.1 | Marinomonas arctica |
| 44 | 1538466 | 1538738 | - | NZ_CP030789.1 | Vibrio campbellii |
| 45 | 1250750 | 1251022 | + | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 46 | 1544481 | 1544753 | - | NC_013457.1 | Vibrio antiquarius |
| 47 | 1050756 | 1051028 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 48 | 1857692 | 1857964 | + | NZ_CP011257.1 | Ralstonia mannitolilytica |
| 49 | 1100036 | 1100308 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 50 | 1457777 | 1458049 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 51 | 207931 | 208203 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 52 | 1290984 | 1291256 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 53 | 1092782 | 1093054 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 54 | 1439376 | 1439648 | - | NZ_CP012944.1 | Ralstonia solanacearum |
| 55 | 4674133 | 4674405 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 56 | 1222563 | 1222835 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 57 | 4594792 | 4595064 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 58 | 1046595 | 1046867 | + | NC_015968.1 | Enterobacter soli |
| 59 | 2552071 | 2552343 | + | NZ_CP043473.1 | Chromobacterium paludis |
| 60 | 4256002 | 4256274 | - | NZ_CP054254.1 | Klebsiella variicola |
| 61 | 2897807 | 2898079 | - | NZ_CP016171.1 | Bordetella bronchialis |
| 62 | 3610964 | 3611236 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 63 | 3988288 | 3988560 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 64 | 3762072 | 3762344 | + | NZ_CP016022.1 | Ralstonia insidiosa |
| 65 | 1125122 | 1125397 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 66 | 3791651 | 3791923 | + | NC_005085.1 | Chromobacterium violaceum ATCC 12472 |
| 67 | 484500 | 484772 | + | NZ_CP029495.1 | Chromobacterium phragmitis |
| 68 | 1787479 | 1787751 | + | NZ_CP017707.1 | Chromobacterium vaccinii |
| 69 | 2797816 | 2798085 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 70 | 2807486 | 2807755 | + | NC_008260.1 | Alcanivorax borkumensis SK2 |
| 71 | 37337 | 37567 | - | NC_023018.2 | Pandoraea pnomenusa |
| 72 | 54676 | 54915 | - | NZ_CP013480.3 | Pandoraea norimbergensis |
| 73 | 91687 | 91917 | - | NZ_CP047385.1 | Pandoraea fibrosis |
| 74 | 4707504 | 4707782 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 75 | 31495 | 31725 | - | NZ_LT906435.1 | Pandoraea sputorum |
| 76 | 715011 | 715286 | - | NZ_LR134376.1 | Aeromonas encheleia |
| 77 | 5441784 | 5442014 | + | NZ_CP013481.2 | Pandoraea apista |
| 78 | 670271 | 670546 | - | NZ_AP022188.1 | Aeromonas media |
| 79 | 66141 | 66410 | - | NZ_CP010310.2 | Pandoraea pulmonicola |
| 80 | 22774 | 23004 | - | NZ_CP011807.3 | Pandoraea faecigallinarum |
| 81 | 3385807 | 3386082 | + | NZ_CP040449.1 | Aeromonas simiae |
| 82 | 660447 | 660722 | - | NZ_CP050851.1 | Aeromonas hydrophila |
| 83 | 1408999 | 1409274 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 84 | 2838203 | 2838478 | + | NZ_CP051883.1 | Aeromonas salmonicida |
| 85 | 4045235 | 4045510 | - | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 86 | 3790495 | 3790770 | - | NZ_CP044060.1 | Aeromonas veronii |
| 87 | 100950 | 101228 | - | NC_012880.1 | Musicola paradisiaca Ech703 |
| 88 | 1434404 | 1434679 | + | NZ_LT906479.1 | Serratia ficaria |
| 89 | 1771674 | 1771949 | - | NC_013851.1 | Allochromatium vinosum DSM 180 |
| 90 | 21404 | 21634 | - | NZ_CP011253.3 | Pandoraea oxalativorans |
| 91 | 670781 | 671056 | + | NZ_CP016948.1 | Serratia surfactantfaciens |
| 92 | 53972 | 54202 | - | NZ_CP010897.2 | Pandoraea vervacti |
| 93 | 1557749 | 1558024 | + | NZ_LR134378.1 | Lautropia mirabilis |
| 94 | 1365166 | 1365441 | + | NZ_CP038662.1 | Serratia nematodiphila |
| 95 | 399351 | 399623 | + | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 96 | 2225921 | 2226196 | - | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 97 | 121874 | 122149 | + | NZ_CP005961.1 | Pseudomonas mandelii JR-1 |
| 98 | 3069893 | 3070180 | - | NZ_CP047241.1 | Aquitalea denitrificans |
| 99 | 5832307 | 5832582 | - | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 100 | 3696012 | 3696287 | - | NZ_CP071320.1 | Serratia ureilytica |
| 101 | 4549388 | 4549663 | + | NC_003910.7 | Colwellia psychrerythraea 34H |
| 102 | 4229066 | 4229344 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 103 | 882703 | 882978 | - | NZ_CP013729.1 | Roseateles depolymerans |
| 104 | 4165830 | 4166105 | - | NZ_CP024645.1 | Rhizobacter gummiphilus |
| 105 | 4356703 | 4356981 | + | NZ_LT615367.1 | Dickeya aquatica |
| 106 | 3526763 | 3527038 | - | NZ_CP031222.1 | Aquirhabdus parva |
++ More..