Result : Q3ZZ95
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S21 |
| NCBI Accession ID | AJ965256.1 |
| Organism | Dehalococcoides mccartyi (strain CBDB1) |
| Left | 257583 |
| Right | 257777 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGACGTTAGACCCGAAAATAACGAGAGCTTTGAAAGCATGCTCAAACGTTTTAACCGCAAGGTCCAGCAGGACGGCATTCTTTCCGAAGCACGTCGCCGCACCCGCTTTGAACGCCCCCCGACCCGCCGCAAGCGTAAGGACGCCGCAAAAAGGCGTTTGGCAATAAAAGCCGCCAGAAAGGCCACCTAA |
| Sequence | MADVRPENNESFESMLKRFNRKVQQDGILSEARRRTRFERPPTRRKRKDAAKRRLAIKAARKAT |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed |
| Pubmed ID | 16116419 |
| Domain | CDD:412427 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q3ZZ95 |
| ORF Length (Amino Acid) | 64 |
++ More..
| Conservation Analysis |
No. of Species: 38
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 286273 | 286467 | - | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
| 2 | 98549 | 98752 | + | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
| 3 | 390538 | 390711 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
| 4 | 35035 | 35208 | - | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
| 5 | 905608 | 905784 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 6 | 1264002 | 1264202 | + | NC_013894.1 | Thermocrinis albus DSM 14484 |
| 7 | 396973 | 397149 | - | NZ_CP047242.1 | Trichormus variabilis 0441 |
| 8 | 1026067 | 1026231 | + | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
| 9 | 2667540 | 2667716 | - | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 10 | 160040 | 160255 | - | NZ_CP035688.1 | Vibrio metoecus |
| 11 | 515539 | 515754 | - | NZ_CP033078.1 | Vibrio zhugei |
| 12 | 404485 | 404700 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 13 | 382258 | 382473 | - | NZ_AP019651.1 | Vibrio taketomensis |
| 14 | 2663386 | 2663601 | + | NZ_CP047475.1 | Vibrio astriarenae |
| 15 | 2740458 | 2740673 | + | NZ_CP032093.1 | Vibrio alfacsensis |
| 16 | 2685199 | 2685414 | + | NZ_CP045350.1 | Vibrio aquimaris |
| 17 | 2289446 | 2289661 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 18 | 173763 | 173978 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 19 | 2498165 | 2498380 | + | NZ_AP019657.1 | Vibrio ponticus |
| 20 | 2513715 | 2513930 | + | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 21 | 524081 | 524296 | - | NZ_CP044069.1 | Vibrio vulnificus |
| 22 | 11100 | 11315 | + | NC_013456.1 | Vibrio antiquarius |
| 23 | 377507 | 377722 | - | NZ_CP030788.1 | Vibrio campbellii |
| 24 | 964476 | 964691 | - | NZ_CP040990.1 | Vibrio furnissii |
| 25 | 2859724 | 2859939 | + | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 26 | 417079 | 417294 | - | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 27 | 2726057 | 2726272 | + | NZ_CP018312.1 | Vibrio rotiferianus |
| 28 | 521847 | 522062 | - | NZ_AP014635.1 | Vibrio tritonius |
| 29 | 1435235 | 1435450 | + | NZ_CP019959.1 | Vibrio owensii |
| 30 | 594028 | 594243 | - | NZ_CP009467.1 | Vibrio harveyi |
| 31 | 193952 | 194167 | - | NZ_LT960611.1 | Vibrio tapetis subsp. tapetis |
| 32 | 3046160 | 3046375 | + | NZ_CP046268.1 | Vibrio spartinae |
| 33 | 428071 | 428286 | - | NZ_CP022741.1 | Vibrio qinghaiensis |
| 34 | 1311906 | 1312121 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 35 | 1012525 | 1012740 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 36 | 407111 | 407326 | - | NC_011753.2 | Vibrio atlanticus |
| 37 | 2854388 | 2854603 | + | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 38 | 1850593 | 1850808 | + | NZ_CP025792.1 | Vibrio jasicida 090810c |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP035688.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF09424.12 | 0.84 | 32 | 29.0 | same-strand | Yqey-like protein |
| 2 | PF04546.15 | 0.76 | 29 | 2440 | same-strand | Sigma-70, non-essential region |
| 3 | PF04539.18 | 0.76 | 29 | 2440 | same-strand | Sigma-70 region 3 |
| 4 | PF03979.16 | 0.76 | 29 | 2440 | same-strand | Sigma-70 factor, region 1.1 |
| 5 | PF04542.16 | 0.76 | 29 | 2440 | same-strand | Sigma-70 region 2 |
| 6 | PF04545.18 | 0.76 | 29 | 2440 | same-strand | Sigma-70, region 4 |
| 7 | PF00140.22 | 0.76 | 29 | 2440 | same-strand | Sigma-70 factor, region 1.2 |
| 8 | PF08275.13 | 0.76 | 29 | 589 | same-strand | DNA primase catalytic core, N-terminal domain |
| 9 | PF01807.22 | 0.76 | 29 | 589 | same-strand | CHC2 zinc finger |
| 10 | PF08278.13 | 0.76 | 29 | 589 | same-strand | DNA primase DnaG DnaB-binding |
| 11 | PF13155.8 | 0.76 | 29 | 589 | same-strand | Toprim-like |
| 12 | PF13662.8 | 0.76 | 29 | 589 | same-strand | Toprim domain |
| 13 | PF10410.11 | 0.68 | 26 | 590.5 | same-strand | DnaB-helicase binding domain of primase |
| 14 | PF01751.24 | 0.76 | 29 | 589 | same-strand | Toprim domain |
| 15 | PF13362.8 | 0.76 | 29 | 589 | same-strand | Toprim domain |
| 16 | PF00814.27 | 0.76 | 29 | 232 | opposite-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
| 17 | PF12697.9 | 0.68 | 26 | 1418.0 | opposite-strand | Alpha/beta hydrolase family |
| 18 | PF02660.17 | 0.74 | 28 | 2278.5 | same-strand | Glycerol-3-phosphate acyltransferase |
| 19 | PF02152.20 | 0.74 | 28 | 3094.0 | opposite-strand | Dihydroneopterin aldolase |
| 20 | PF01288.22 | 0.74 | 28 | 3448.0 | opposite-strand | 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) |
++ More..