Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L32 |
NCBI Accession ID | AJ965256.1 |
Organism | Dehalococcoides mccartyi (strain CBDB1) |
Left | 971056 |
Right | 971274 |
Strand | + |
Nucleotide Sequence | ATGGCTCTACCTAAAAGAAGACTTTCCCATTCCCGCCAGGGCAATCACCGGGCTCACGTAGCCCTTACCGCCCCGGCTGTAATGGAATGCCCCCAGTGCAACAGCCCCAAGCTCTCTCATCAAGCCTGTTCCGTCTGCGGTACTTACAATGGACGGACTGTGATTGATATGGAAGCTATTGCCAAGAAAAAAGCTGATAAATCCAAGGGTCAGCAGTAG |
Sequence | MALPKRRLSHSRQGNHRAHVALTAPAVMECPQCNSPKLSHQACSVCGTYNGRTVIDMEAIAKKKADKSKGQQ |
Source of smORF | Swiss-Prot |
Function | The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification] |
Pubmed ID | 16116419 |
Domain | CDD:415589 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q3ZYG8 |
ORF Length (Amino Acid) | 72 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1079329 | 1079547 | + | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
2 | 284250 | 284471 | + | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
3 | 1751670 | 1751852 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
4 | 2873184 | 2873366 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
5 | 2175466 | 2175648 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
6 | 1798827 | 1799009 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
7 | 1483349 | 1483537 | - | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
8 | 2301030 | 2301218 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
9 | 1977511 | 1977708 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
10 | 1775742 | 1775924 | + | NZ_CP009788.1 | Geobacter pickeringii |
11 | 1518673 | 1518855 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
12 | 695115 | 695303 | + | NZ_CP029256.1 | Christensenella minuta |
13 | 2603299 | 2603487 | - | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
14 | 1275152 | 1275334 | + | NZ_AP023213.1 | Citrifermentans bremense |
15 | 239050 | 239232 | + | NZ_CP042909.1 | Thermosulfurimonas marina |
16 | 4250446 | 4250622 | - | NZ_AP018449.1 | Methylomusa anaerophila |
17 | 1845472 | 1845651 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
18 | 3597790 | 3597972 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
19 | 2269010 | 2269198 | - | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
20 | 1153792 | 1153971 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
21 | 4600859 | 4601038 | - | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
22 | 1542477 | 1542656 | - | NZ_CP018221.1 | Tardibacter chloracetimidivorans |
23 | 2092662 | 2092847 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
24 | 7703036 | 7703236 | + | NZ_CP042425.1 | Limnoglobus roseus |
25 | 4203459 | 4203635 | + | NC_011768.1 | Desulfatibacillum aliphaticivorans |
26 | 1787810 | 1787998 | - | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
27 | 3156156 | 3156344 | - | NC_006138.1 | Desulfotalea psychrophila LSv54 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF02620.19 | 0.74 | 20 | 22.0 | same-strand | Large ribosomal RNA subunit accumulation protein YceD |
2 | PF02504.17 | 0.78 | 21 | 31 | same-strand | Fatty acid synthesis protein |
3 | PF08541.12 | 0.7 | 19 | 1098 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal |
4 | PF08545.12 | 0.7 | 19 | 1098 | same-strand | 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III |