Result : Q3ZYG8

Protein Information

• Protein name: 50S ribosomal protein L32
• NCBI Accession ID: AJ965256.1
• Organism: Dehalococcoides mccartyi (strain CBDB1)
• Left: 971056
• Right: 971274
• Strand: +
• Nucleotide Sequence: ATGGCTCTACCTAAAAGAAGACTTTCCCATTCCCGCCAGGGCAATCACCGGGCTCACGTAGCCCTTACCGCCCCGGCTGTAATGGAATGCCCCCAGTGCAACAGCCCCAAGCTCTCTCATCAAGCCTGTTCCGTCTGCGGTACTTACAATGGACGGACTGTGATTGATATGGAAGCTATTGCCAAGAAAAAAGCTGATAAATCCAAGGGTCAGCAGTAG
• Sequence: MALPKRRLSHSRQGNHRAHVALTAPAVMECPQCNSPKLSHQACSVCGTYNGRTVIDMEAIAKKKADKSKGQQ
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl09115. Profile Description: Ribosomal L32p protein family. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus. [Protein synthesis, Ribosomal proteins: synthesis and modification]
• Pubmed ID: 16116419
• Domain: CDD:415589
• Functional Category: Ribosomal_protein
• Uniprot ID: Q3ZYG8
• ORF Length (Amino Acid): 72

Conservation Analysis

No. of Species: 27

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1079329	1079547	+	NZ_CP006950.1	Dehalococcoides mccartyi CG4
2	284250	284471	+	NC_014314.1	Dehalogenimonas lykanthroporepellens BL-DC-9
3	1751670	1751852	+	NC_002939.5	Geobacter sulfurreducens PCA
4	2873184	2873366	+	NC_011979.1	Geobacter daltonii FRC-32
5	2175466	2175648	+	NC_009483.1	Geobacter uraniireducens Rf4
6	1798827	1799009	+	NC_007517.1	Geobacter metallireducens GS-15
7	1483349	1483537	-	NC_015519.1	Tepidanaerobacter acetatoxydans Re1
8	2301030	2301218	-	NC_014972.1	Desulfobulbus propionicus DSM 2032
9	1977511	1977708	+	NZ_CP051131.1	Parasphingopyxis algicola
10	1775742	1775924	+	NZ_CP009788.1	Geobacter pickeringii
11	1518673	1518855	-	NC_014216.1	Desulfurivibrio alkaliphilus AHT 2
12	695115	695303	+	NZ_CP029256.1	Christensenella minuta
13	2603299	2603487	-	NZ_CP054140.1	Desulfobulbus oligotrophicus
14	1275152	1275334	+	NZ_AP023213.1	Citrifermentans bremense
15	239050	239232	+	NZ_CP042909.1	Thermosulfurimonas marina
16	4250446	4250622	-	NZ_AP018449.1	Methylomusa anaerophila
17	1845472	1845651	-	NC_016803.1	Pseudodesulfovibrio mercurii
18	3597790	3597972	-	NC_011146.1	Citrifermentans bemidjiense Bem
19	2269010	2269198	-	NC_012483.1	Acidobacterium capsulatum ATCC 51196
20	1153792	1153971	+	NC_014831.1	Thermaerobacter marianensis DSM 12885
21	4600859	4601038	-	NZ_CP023449.1	Rhizorhabdus dicambivorans
22	1542477	1542656	-	NZ_CP018221.1	Tardibacter chloracetimidivorans
23	2092662	2092847	-	NZ_CP030840.1	Acidisarcina polymorpha
24	7703036	7703236	+	NZ_CP042425.1	Limnoglobus roseus
25	4203459	4203635	+	NC_011768.1	Desulfatibacillum aliphaticivorans
26	1787810	1787998	-	NC_015681.1	Thermodesulfatator indicus DSM 15286
27	3156156	3156344	-	NC_006138.1	Desulfotalea psychrophila LSv54

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_002939.5

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF02620.19	0.74	20	22.0	same-strand	Large ribosomal RNA subunit accumulation protein YceD
2	PF02504.17	0.78	21	31	same-strand	Fatty acid synthesis protein
3	PF08541.12	0.7	19	1098	same-strand	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal
4	PF08545.12	0.7	19	1098	same-strand	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III