Result : Q3ZXY7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | AJ965256.1 |
| Organism | Dehalococcoides mccartyi (strain CBDB1) |
| Left | 807836 |
| Right | 808111 |
| Strand | + |
| Nucleotide Sequence | ATGCATTGTCTGAGAGCCATTGTCAAAGGGAAGGTACAGGGAGTTTACTTCAGAGACTTCACCCGAACACAGGCAACGCGTCTGGGTCTTTGCGGATACGCCAAAAACCTGGCCAACGGGGCTGAAGTGGAAGTGGTAGCTGAAGGAGACAAAGACGCACTCCTTGAGTTCTTGGATTTACTCCGTTCAGGTCCTCCCCGTGCCGAGGTTAAAGATGTGGAAACCAGCTGGGAAACAGCAACCGCCAACTACAGTGATTTCCGCATCAAGCATTAA |
| Sequence | MHCLRAIVKGKVQGVYFRDFTRTQATRLGLCGYAKNLANGAEVEVVAEGDKDALLEFLDLLRSGPPRAEVKDVETSWETATANYSDFRIKH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 16116419 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q3ZXY7 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 27
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1442582 | 1442821 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 2 | 2120915 | 2121154 | - | NZ_CP058215.1 | Methanolobus zinderi |
| 3 | 975407 | 975679 | - | NZ_AP018930.1 | Sulfuracidifex tepidarius |
| 4 | 465388 | 465654 | + | NZ_CP016312.1 | Thermus brockianus |
| 5 | 2121110 | 2121376 | - | NZ_AP018724.1 | Sulfurivermis fontis |
| 6 | 139763 | 140026 | - | NZ_CP031500.1 | Deinococcus radiodurans |
| 7 | 3337574 | 3337807 | - | NZ_CP064030.1 | Dyella caseinilytica |
| 8 | 528666 | 528932 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 9 | 1448572 | 1448838 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 10 | 2336725 | 2336958 | - | NZ_CP017146.1 | Marisediminicola antarctica |
| 11 | 1085275 | 1085508 | + | NC_014221.1 | Truepera radiovictrix DSM 17093 |
| 12 | 1265912 | 1266178 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
| 13 | 3545100 | 3545324 | - | NZ_CP035704.1 | Pseudolysobacter antarcticus |
| 14 | 5717548 | 5717775 | - | NZ_LR134352.1 | Nocardia asteroides |
| 15 | 1038767 | 1039036 | + | NZ_CP046603.1 | Lysobacter soli |
| 16 | 2228702 | 2228971 | + | NZ_CP060820.1 | Lysobacter solisilvae (ex Woo and Kim 2020) |
| 17 | 981643 | 981891 | + | NC_013159.1 | Saccharomonospora viridis DSM 43017 |
| 18 | 2917075 | 2917344 | - | NZ_CP029843.1 | Lysobacter maris |
| 19 | 1941494 | 1941763 | + | NZ_CP027433.1 | Gordonia iterans |
| 20 | 2728329 | 2728598 | - | NZ_CP041242.1 | Lysobacter alkalisoli |
| 21 | 1915573 | 1915842 | - | NZ_CP071517.1 | Lysobacter arenosi |
| 22 | 2523667 | 2523936 | - | NZ_CP017415.1 | Acidihalobacter yilgarnenesis |
| 23 | 5531632 | 5531859 | - | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
| 24 | 1392240 | 1392479 | + | NC_012779.2 | Edwardsiella ictaluri 93-146 |
| 25 | 4536376 | 4536645 | - | NZ_CP011129.1 | Lysobacter antibioticus |
| 26 | 1652868 | 1653128 | - | NZ_CP007790.1 | Corynebacterium marinum DSM 44953 |
| 27 | 3053074 | 3053340 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
++ More..