Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L23 |
NCBI Accession ID | CP000027.1 |
Organism | Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) (Dehalococcoides ethenogenes (strain 195)) |
Left | 447045 |
Right | 447329 |
Strand | + |
Nucleotide Sequence | ATGAATTTATACGAAGTATTGCGCCGGCCGTTAATATCTGAAAAGAACAGTGTTCAAGCTGTCCAGAATAAATACGTTTTTGAAATAGCCAAAGGTGCCAACAAACGTATGGTAAAGCTGGCAGTGGAACAGGCTTTTAATGTAACTGTTGAAGATGTAAACATGCTTCACATACCGGGCAAACAAAAGCGGATGGGGCGCAATCTGGTCCAGACCGCAGGGTTGCGTAAAGCCATCATCACTCTCAAAGAGGGTGATAAAATAACTCTATTTGAGGGTGTTTAG |
Sequence | MNLYEVLRRPLISEKNSVQAVQNKYVFEIAKGANKRMVKLAVEQAFNVTVEDVNMLHIPGKQKRMGRNLVQTAGLRKAIITLKEGDKITLFEGV |
Source of smORF | Swiss-Prot |
Function | One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000255|HAMAP-Rule:MF_01369}. |
Pubmed ID | 15637277 |
Domain | CDD:412311 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q3Z979 |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 397699 | 397983 | + | NZ_CP006950.1 | Dehalococcoides mccartyi CG4 |
2 | 1076058 | 1076342 | - | NC_014314.1 | Dehalogenimonas lykanthroporepellens BL-DC-9 |
3 | 1867299 | 1867595 | + | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
4 | 1405154 | 1405384 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
5 | 1118800 | 1119066 | + | NC_014960.1 | Anaerolinea thermophila UNI-1 |
6 | 431743 | 432027 | + | NZ_CP017560.1 | Sporosarcina ureilytica |
7 | 3007494 | 3007772 | - | NZ_CP015249.1 | Dokdonella koreensis DS-123 |
8 | 4177537 | 4177809 | - | NZ_CP027860.1 | Ahniella affigens |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00009.29 | 1.0 | 8 | 2420.0 | same-strand | Elongation factor Tu GTP binding domain |
2 | PF03764.20 | 0.75 | 6 | 2890.5 | same-strand | Elongation factor G, domain IV |
3 | PF14492.8 | 0.75 | 6 | 2890.5 | same-strand | Elongation Factor G, domain III |
4 | PF00679.26 | 0.75 | 6 | 2890.5 | same-strand | Elongation factor G C-terminus |
5 | PF03144.27 | 1.0 | 8 | 2420.0 | same-strand | Elongation factor Tu domain 2 |
6 | PF00338.24 | 1.0 | 8 | 1301.5 | same-strand | Ribosomal protein S10p/S20e |
7 | PF00573.24 | 1.0 | 8 | 12.0 | same-strand | Ribosomal protein L4/L1 family |
8 | PF03947.20 | 1.0 | 8 | 13.5 | same-strand | Ribosomal Proteins L2, C-terminal domain |
9 | PF00181.25 | 1.0 | 8 | 13.5 | same-strand | Ribosomal Proteins L2, RNA binding domain |
10 | PF00203.23 | 1.0 | 8 | 856.0 | same-strand | Ribosomal protein S19 |
11 | PF00237.21 | 1.0 | 8 | 1158.5 | same-strand | Ribosomal protein L22p/L17e |
12 | PF00189.22 | 1.0 | 8 | 1502.0 | same-strand | Ribosomal protein S3, C-terminal domain |
13 | PF07650.19 | 1.0 | 8 | 1502.0 | same-strand | KH domain |
14 | PF00252.20 | 1.0 | 8 | 2256.0 | same-strand | Ribosomal protein L16p/L10e |
15 | PF01926.25 | 0.75 | 6 | 2420.0 | same-strand | 50S ribosome-binding GTPase |
16 | PF03143.19 | 0.75 | 6 | 1927.5 | same-strand | Elongation factor Tu C-terminal domain |